KEGG   Dictyoglomus thermophilum: DICTH_0745Help
Entry
DICTH_0745        CDS       T00774                                 

Definition
(GenBank) alpha-amylase 1
  KO
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICTH_0745
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DICTH_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
756064..758124
Genome map
AA seq 686 aa AA seqDB search
MTKSIYFSLGIHNHQPVGNFDFVIERAYEMSYKPLINFFFKHPDFPINVHFSGFLLLWLE
KNHPEYFEKLKIMAERGQIEFVSGGFYEPILPIIPDKDKVQQIKKLNKYIYDKFGQTPKG
MWLAERVWEPHLVKYIAEAGIEYVVVDDAHFFSVGLKEEDLFGYYLMEEQGYKLAVFPIS
MKLRYLIPFADPEETITYLDKFASEDKSKIALLFDDGEKFGLWPDTYRTVYEEGWLETFV
SKIKENFLLVTPVNLYTYMQRVKPKGRIYLPTASYREMMEWVLFPEAQKELEELVEKLKT
ENLWDKFSPYVKGGFWRNFLAKYDESNHMQKKMLYVWKKVQDSPNEEVKEKAMEEVFQGQ
ANDAYWHGIFGGLYLPHLRTAIYEHLIKAENYLENSEIRFNIFDFDCDGNDEIIVESPFF
NLYLSPNHGGSVLEWDFKTKAFNLTNVLTRRKEAYHSKLSYVTSEAQGKSIHERWTAKEE
GLENILFYDNHRRVSFTEKIFESEPVLEDLWKDSSRLEVDSFYENYDYEINKDENKIRVL
FSGVFRGFELCKSYILYKDKSFVDVVYEIKNVSETPISLNFGWEINLNFLAPNHPDYYFL
IGDQKYPLSSFGIEKVNNWKIFSGIGIELECVLDVEASLYRYPIETVSLSEEGFERVYQG
SALIHFYKVDLPVGSTWRTTIRFWVK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaagtatatatttttcattaggaatacacaaccatcaacctgtaggtaatttt
gattttgtaattgaaagagcttatgagatgagttacaaacctcttattaattttttcttt
aaacatcctgattttcctataaatgttcacttttcaggttttttacttctttggcttgaa
aaaaatcatcctgagtattttgaaaaattaaagattatggcagaaaggggacaaattgag
tttgtaagtggaggtttctatgagccgatcttacccataatacctgataaagataaagtc
cagcaaataaagaagttaaacaaatatatttacgataagtttggtcaaactcctaaggga
atgtggcttgctgagagggtttgggaacctcatcttgtgaaatatattgcagaagcaggt
attgaatatgtggtagtagatgatgctcatttcttttctgtaggattaaaggaagaggat
ctttttggctattatcttatggaggagcaaggatataagcttgcggtgtttcccataagt
atgaaattacgatacctgattccctttgctgatccagaggaaactattacatatctcgat
aaatttgcttcagaagataaaagtaaaattgctcttttgtttgatgatggagagaaattt
ggactttggcctgatacttacaggactgtgtatgaagaaggctggttggaaacatttgta
agtaagataaaagaaaattttttgttagtaacacctgttaatttatatacctatatgcaa
agggtaaagccaaagggaagaatatatcttcccacagcttcttatagagagatgatggaa
tgggttttgtttcctgaagctcagaaagaactcgaagaattagtagaaaaacttaaaaca
gagaatttatgggataagttttctccttatgtaaaaggtggtttttggaggaattttctt
gctaaatatgacgaatctaatcatatgcaaaagaaaatgctttatgtttggaaaaaagtt
caagattcccctaatgaagaagttaaggaaaaggcgatggaggaggtctttcaaggacaa
gcaaacgatgcatattggcatggtatctttggggggctttatcttccacatctgaggacg
gctatatatgaacacttgattaaagcggaaaattatctggaaaatagtgagatacgcttt
aatatctttgattttgattgtgatggaaatgacgagataattgttgaatctccatttttt
aatttgtatctttcgccaaatcatgggggatctgtacttgaatgggattttaagactaag
gctttcaatctcactaatgtcttaactagaagaaaagaagcctatcattctaagttatct
tatgtgacatctgaggctcaggggaaaagtatacatgagagatggactgctaaagaagaa
ggattagagaatattctattttacgataatcataggagagtttcttttaccgaaaagatt
tttgagagtgagcctgtccttgaagatctatggaaagatagttcaagacttgaagttgat
agtttttatgaaaattatgattatgaaataaacaaagatgagaataaaattagagtttta
ttcagtggagtttttagaggatttgagctttgtaagagttatattctttacaaagataaa
agttttgttgatgtggtgtatgagattaagaatgtttcagaaacacctataagtctaaat
ttcggatgggaaataaatttgaactttttagctcctaatcatcctgattattattttttg
ataggtgatcaaaaatatcctctctcttcttttggtatagagaaagttaataattggaaa
atattctctggtataggaatagaattagagtgtgtattagatgtagaggctagtttatat
aggtatccaatagagactgtatctttatctgaggagggatttgagagagtttatcaggga
agtgctcttattcacttctacaaagtagatttaccagttggttcaacttggagaactacc
ataagattttgggttaagtaa

DBGET integrated database retrieval system