KEGG   Dictyoglomus thermophilum: DICTH_0745Help
Entry
DICTH_0745        CDS       T00774                                 

Definition
(GenBank) alpha-amylase 1
  KO
K22451  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00500  Starch and sucrose metabolism
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICTH_0745
Enzymes [BR:dth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DICTH_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1926 Glyco_hydro_57 DUF1925 Glyco_hydro_38
Motif
Other DBs
NCBI-ProteinID: ACI18637
UniProt: P09961
LinkDB All DBs
Position
756064..758124
Genome map
AA seq 686 aa AA seqDB search
MTKSIYFSLGIHNHQPVGNFDFVIERAYEMSYKPLINFFFKHPDFPINVHFSGFLLLWLE
KNHPEYFEKLKIMAERGQIEFVSGGFYEPILPIIPDKDKVQQIKKLNKYIYDKFGQTPKG
MWLAERVWEPHLVKYIAEAGIEYVVVDDAHFFSVGLKEEDLFGYYLMEEQGYKLAVFPIS
MKLRYLIPFADPEETITYLDKFASEDKSKIALLFDDGEKFGLWPDTYRTVYEEGWLETFV
SKIKENFLLVTPVNLYTYMQRVKPKGRIYLPTASYREMMEWVLFPEAQKELEELVEKLKT
ENLWDKFSPYVKGGFWRNFLAKYDESNHMQKKMLYVWKKVQDSPNEEVKEKAMEEVFQGQ
ANDAYWHGIFGGLYLPHLRTAIYEHLIKAENYLENSEIRFNIFDFDCDGNDEIIVESPFF
NLYLSPNHGGSVLEWDFKTKAFNLTNVLTRRKEAYHSKLSYVTSEAQGKSIHERWTAKEE
GLENILFYDNHRRVSFTEKIFESEPVLEDLWKDSSRLEVDSFYENYDYEINKDENKIRVL
FSGVFRGFELCKSYILYKDKSFVDVVYEIKNVSETPISLNFGWEINLNFLAPNHPDYYFL
IGDQKYPLSSFGIEKVNNWKIFSGIGIELECVLDVEASLYRYPIETVSLSEEGFERVYQG
SALIHFYKVDLPVGSTWRTTIRFWVK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaagtatatatttttcattaggaatacacaaccatcaacctgtaggtaatttt
gattttgtaattgaaagagcttatgagatgagttacaaacctcttattaattttttcttt
aaacatcctgattttcctataaatgttcacttttcaggttttttacttctttggcttgaa
aaaaatcatcctgagtattttgaaaaattaaagattatggcagaaaggggacaaattgag
tttgtaagtggaggtttctatgagccgatcttacccataatacctgataaagataaagtc
cagcaaataaagaagttaaacaaatatatttacgataagtttggtcaaactcctaaggga
atgtggcttgctgagagggtttgggaacctcatcttgtgaaatatattgcagaagcaggt
attgaatatgtggtagtagatgatgctcatttcttttctgtaggattaaaggaagaggat
ctttttggctattatcttatggaggagcaaggatataagcttgcggtgtttcccataagt
atgaaattacgatacctgattccctttgctgatccagaggaaactattacatatctcgat
aaatttgcttcagaagataaaagtaaaattgctcttttgtttgatgatggagagaaattt
ggactttggcctgatacttacaggactgtgtatgaagaaggctggttggaaacatttgta
agtaagataaaagaaaattttttgttagtaacacctgttaatttatatacctatatgcaa
agggtaaagccaaagggaagaatatatcttcccacagcttcttatagagagatgatggaa
tgggttttgtttcctgaagctcagaaagaactcgaagaattagtagaaaaacttaaaaca
gagaatttatgggataagttttctccttatgtaaaaggtggtttttggaggaattttctt
gctaaatatgacgaatctaatcatatgcaaaagaaaatgctttatgtttggaaaaaagtt
caagattcccctaatgaagaagttaaggaaaaggcgatggaggaggtctttcaaggacaa
gcaaacgatgcatattggcatggtatctttggggggctttatcttccacatctgaggacg
gctatatatgaacacttgattaaagcggaaaattatctggaaaatagtgagatacgcttt
aatatctttgattttgattgtgatggaaatgacgagataattgttgaatctccatttttt
aatttgtatctttcgccaaatcatgggggatctgtacttgaatgggattttaagactaag
gctttcaatctcactaatgtcttaactagaagaaaagaagcctatcattctaagttatct
tatgtgacatctgaggctcaggggaaaagtatacatgagagatggactgctaaagaagaa
ggattagagaatattctattttacgataatcataggagagtttcttttaccgaaaagatt
tttgagagtgagcctgtccttgaagatctatggaaagatagttcaagacttgaagttgat
agtttttatgaaaattatgattatgaaataaacaaagatgagaataaaattagagtttta
ttcagtggagtttttagaggatttgagctttgtaagagttatattctttacaaagataaa
agttttgttgatgtggtgtatgagattaagaatgtttcagaaacacctataagtctaaat
ttcggatgggaaataaatttgaactttttagctcctaatcatcctgattattattttttg
ataggtgatcaaaaatatcctctctcttcttttggtatagagaaagttaataattggaaa
atattctctggtataggaatagaattagagtgtgtattagatgtagaggctagtttatat
aggtatccaatagagactgtatctttatctgaggagggatttgagagagtttatcaggga
agtgctcttattcacttctacaaagtagatttaccagttggttcaacttggagaactacc
ataagattttgggttaagtaa

DBGET integrated database retrieval system