KEGG   Delftia tsuruhatensis: BI380_01015Help
Entry
BI380_01015       CDS       T04496                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
dts  Delftia tsuruhatensis
Brite
Enzymes [BR:dts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     BI380_01015
Lipid biosynthesis proteins [BR:dts01004]
 Acyl-CoA synthetase
  Unknown
   BI380_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
197292..198983
Genome map
AA seq 563 aa AA seqDB search
MSTLPAHHAFWPSRLPHSITVPATSVWENLAVNARRYPDKPAIRYFGSSISYRELCEGTE
RMAAYLHSLGVQRGDRVILLMQNTPQLILAHYAIFRANAVVVPVNPMNMAEELKHYITDA
DAKVAITTADLAPELAKASNALAPGQRLDHLIVTQFTDAFDAGVQGDDAPPAQWHDWLLT
RREPAVLEGGSVHTWQQALACTDAAPPHVVGRDDMAVLPYTSGTTGHPKGCMHPHRSINH
NAVAGSYWGSGTSEAVVLAVVPMFHITGMVSVLHTAIFMGATVVVMPRWDRELAGRLISR
YQVTSWTNIPTMVIDLLGSPNFAQFDLTSLKYIGGGGAAMPQAVAQRLLEQYGLRFCEGY
GLTETAAPTHSNPSEHPKQQCLGIPFMSTEARVIDPDTGAEVPQGEQGEIVVHGPEVFDG
YWKRPDATAQVFMEIDGKRFFRTGDLGHVDEDGYYFITDRLKRMINASGFKVWPAEVESL
MFRHPAIQEACVISTRDAYRGESVKAVVVLRAGKEDTTAEDIIQWCRENMAVYKAPKVVE
FVKALPKSGSGKVMWRQLQEAQA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccctgcccgcgcaccacgccttctggcccagccgtctgccccattccatcacc
gtgcccgccaccagcgtatgggagaacctggccgtcaacgcgcgccgctatcccgacaag
ccggccatccgctacttcggcagctccatcagctaccgcgagctgtgcgagggcacggag
cgcatggcggcctacctgcacagcctgggcgtgcagcgcggcgaccgcgtgatcctgctg
atgcagaacacgcctcagctcatcctggcgcactacgccatcttccgcgccaatgccgtg
gtggtgccggtcaatcccatgaacatggccgaggagctcaagcactacatcaccgacgcc
gacgccaaggtcgccatcaccacggccgacctggcccccgaactggccaaggccagcaac
gcgctggcgccgggccagcggctcgatcacctgatcgtcacccagttcaccgatgccttc
gatgccggtgtgcagggcgacgatgcgccgcctgcgcagtggcacgactggctgctcacc
cggcgcgagccggctgtgctggagggcggcagcgtccacacctggcagcaggccctggcc
tgcaccgacgctgcgccgccccatgtggtgggccgcgacgacatggccgtgctgccctac
accagcggcaccacgggccaccccaagggctgcatgcacccgcaccgctccatcaaccac
aacgccgtggccggcagctactggggcagcggcaccagcgaggcggtcgtgctggcggtg
gtgcccatgttccacatcacgggcatggtgtcggtgctgcacacggccatcttcatgggt
gccaccgtggtggtcatgccgcgctgggaccgcgagctggccgggcggcttatctcgcgc
taccaggtcaccagctggaccaacatccccaccatggtcatcgacctgctgggcagcccc
aacttcgcgcagttcgacctcaccagcctcaagtacatcggcggcggcggcgcggccatg
ccccaggccgtggcccagcgcctgctggagcaatacggcctgcgcttttgcgagggctac
ggcctgaccgagaccgctgcgcccacgcacagcaacccgtccgagcaccccaagcagcag
tgcctgggcattcccttcatgagcacggaggcgcgcgtcatcgatcctgacaccggtgcc
gaagtgccccagggcgagcagggcgagatcgtggtccacgggcccgaggtcttcgacggc
tactggaagcgccccgacgccacggcccaggtcttcatggagatcgacggcaagcggttc
tttcgcaccggcgacctgggccacgtggatgaggacggctactacttcatcaccgaccgc
ctcaagcgcatgatcaacgccagcggcttcaaggtctggccggctgaggtcgagtcgctg
atgttccgccaccccgccatccaggaagcctgcgtgatctccacgcgcgacgcctaccgg
ggcgagtcggtcaaggccgtcgtcgtgctgcgtgccggcaaggaagacaccacggccgag
gacatcatccagtggtgccgcgagaacatggccgtctacaaggcgcccaaggtggtggag
ttcgtcaaggccctgcccaagagcggcagcggcaaggtgatgtggcggcagttgcaggag
gcgcaggcgtag

DBGET integrated database retrieval system