KEGG   Delftia tsuruhatensis: BI380_19980Help
Entry
BI380_19980       CDS       T04496                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dts  Delftia tsuruhatensis
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Quorum sensing
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dts00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BI380_19980
   00071 Fatty acid degradation
    BI380_19980
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BI380_19980
Enzymes [BR:dts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BI380_19980
Lipid biosynthesis proteins [BR:dts01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BI380_19980
Exosome [BR:dts04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BI380_19980
  Exosomal proteins of breast cancer cells
   BI380_19980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4302383..4304062)
Genome map
AA seq 559 aa AA seqDB search
MSDRPWLGAYPAGVPADIDPSQYPSLVALMEEAFSRYADRVAYSFMGKELTYSQVDAQSR
AFAAYLQSLGLARGDRVALMMPNVPQYPVAVAAVLRAGFVVVNVNPLYTARELEHQLKDS
GAKAIVIIENFAHTLQACKAATPVQHMVLCTMGDQLGMLKGAIVNYVVRKVKKLVPPFSL
PGAVRFNDALAKGMRSPFQAPQLQASDMALLQYTGGTTGVSKGAVLLHSNIIANVLQSEA
WNQPAMGKVPAGEQPTSICALPLYHIFAFTVNMMLSMRTGGKTILIPNPRDLKATLKELS
TQRFHSFPAVSTLFNGLANHPDFNTVDWSHLKVSVGGGMAVQSAVAQLWLQKTGCPICEG
YGLSETSPSASCNPVTSTEFSGTIGVPLPSTWMKLVDDEGNDVTTIGERGEVAIKGPQVM
AAYWQRPDETAKVFTADGYFRTGDIGTMDERGYFKIVDRKKDMVLVSGFNVYPNEVEDVV
SNCPGVLECAVVGVPDEKTGEAVKLVIVRKDDSLTEQAVRDFCHDNLTGYKRPRVIEFRT
ELPKTPVGKILRRELRDSK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgcccatggctgggtgcctatccggcaggtgtgcccgccgacatcgatccc
tcccaatacccttcgctggtggccctgatggaggaggccttcagccgctacgcggaccgt
gtggcctattccttcatgggcaaggagctgacctactcacaggtcgatgcgcaaagccgc
gccttcgctgcctatctgcagagcctgggcctggcccgcggcgaccgcgtggcgctgatg
atgcccaacgtgccccagtaccccgtggccgtggccgccgtgctgcgcgccggcttcgtc
gtggtcaacgtcaacccgctgtacacggcgcgagaactggagcaccagctcaaggactcg
ggcgccaaggccatcgtcatcatcgagaacttcgcccacacgctgcaggcctgcaaggcc
gccacgcccgtgcagcacatggtgctgtgcaccatgggcgaccagttgggcatgctcaag
ggcgccatcgtcaattacgtggtgcgcaaggtcaagaagctggtgccgccgttctcgctg
ccaggggccgtgcgcttcaacgacgcgctggccaagggcatgcgctcgcccttccaggcg
ccgcagctgcaggcctccgacatggccctgctgcagtacacgggcggcaccacgggcgtg
agcaagggcgcggtgctgctgcacagcaacatcatcgccaacgtgctgcagtccgaggcc
tggaaccagcccgccatgggcaaggtgccggccggcgagcagcccaccagcatctgcgcg
ctgccgctgtaccacatcttcgccttcacggtgaacatgatgctgtccatgcgcacgggc
ggcaaaaccatcctgattcccaatccgcgcgacctcaaggccactctcaaggagctgtcc
acgcagcgctttcacagcttcccggccgtgagcacgctgttcaacggcctggccaaccac
ccggacttcaacaccgtggactggtcgcacctgaaggtctcggtcggcggcggcatggcg
gtgcaaagcgccgtggcccagctgtggctgcaaaagaccggctgccccatctgcgagggc
tacggcctgtcggagaccagtccctcggccagctgcaaccccgtcacctccaccgagttc
tcgggcaccatcggcgtgcccctgcccagcacctggatgaagctcgtcgatgacgaagga
aacgacgtgaccaccatcggcgagcgcggcgaggtcgccatcaagggcccgcaggtcatg
gccgcctactggcagcgccccgacgaaaccgccaaggtcttcaccgccgacggctacttt
cgcaccggcgacatcggcaccatggacgagcgcggctacttcaagatcgtggaccgcaag
aaggacatggtcctggtcagcggcttcaacgtctatcccaatgaagtggaagacgtggtc
tccaactgccccggcgtgctcgaatgcgccgtggtcggcgtgcccgacgagaagaccggc
gaggccgtcaagctggtcatcgtgcgcaaggacgacagcctcaccgaacaggccgtgcgc
gacttctgccacgacaacctcacgggctacaagcggccccgcgtgatcgagttccgcacc
gaactgcccaagaccccggttggcaagatcctgcgccgggagctgcgcgacagcaagtaa

DBGET integrated database retrieval system