KEGG   Delftia tsuruhatensis: BI380_20715Help
Entry
BI380_20715       CDS       T04496                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4465360..4466859)
Genome map
AA seq 499 aa AA seqDB search
MQPIDFFWRAAERWPQRIAIDAPGGCIRYDALARKVAALAAGLQALEPAVQSRVGICAGN
SADHIAALLAVMASGKVWVPLNPKSTQSEVRRIIDATEPSIVLCDAGGAALVQGAPGIHL
MLGEGTAALEQAQTGAVPVTPELPADAIQAIKFTGGTTGLPKGVMQPCRAWMAGIANQIQ
AWGFDEHDRYVMAAPITHGTSTYLLPILAQGGCHVLLDGAGAEAVRSAFALRGGTVCFMP
PTLIYMLMALPGASRADFPGLRRLIYGGAAMPPEKIRQVRAFFGPVLATTYGQTEAPQIL
TAMRPEDFEDEGLWTSVGRATWFSDLAIMAPDGRLLPRGEVGEVVARGDLLMSGYWRLPG
KTAETLVNGWLHTGDRGLIDAQGYLHLKDRLKDLVITGGFNVYPVDVENALGQHPAVHEC
VVFGIPDDHWGEAVQAAVQLRAELRPDQRPDEAELIAFVRQRLGPVQTPKRIHFHASLPR
SPVGKLLKTAVRELALTPR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccattgattttttctggcgcgcggccgagcgctggccgcagcgcatcgccatc
gacgcaccgggcggctgcatccgctatgacgcgctggcccgcaaggtggccgcgctggcg
gccggcctgcaggcgctggagcccgccgtgcaaagccgcgtgggcatctgcgcgggcaac
agcgcagaccatatcgccgccctgctggcggtgatggccagcggcaaggtctgggtgccg
ctcaatcccaagagcacgcagtccgaggtgcgccgcatcatcgatgccaccgagccctcc
atcgtgctgtgcgatgccggcggcgctgcactggtgcaaggggcgccgggcatccacctg
atgctgggcgagggcacggcggccctggagcaggcgcagaccggcgctgtgcctgtgaca
cccgaactgcccgccgatgccatccaggccatcaagttcacgggcggcaccacgggcctg
cccaagggcgtgatgcagccctgccgcgcctggatggccggcattgccaaccagatccag
gcctgggggttcgatgagcatgaccgctacgtcatggccgcgcccatcacgcatggcacg
tccacctacctgctgcccatcctggcgcagggcggctgccatgtgctgctggatggtgcg
ggtgccgaggccgtgcgcagcgcctttgccctgcgcggcggcaccgtgtgcttcatgccg
cctaccctgatctacatgctgatggcgctgccgggcgccagccgtgcggacttccccggc
ctgcgccgcctcatctacggcggcgccgccatgccgcccgagaaaatccgccaggtgcgc
gccttcttcggccccgtgctggccaccacctatggccagaccgaggctccgcagatcctc
acggccatgcggcccgaggacttcgaggacgaaggcctgtggacctccgtgggccgggcc
acctggttcagcgacctggccatcatggcgcccgacggccgcctgctgccccggggcgag
gtgggcgaggtcgtggcgcgcggcgatctgctgatgagcggctactggcgcctgcccggc
aagacggccgagaccctggtgaacggctggctgcacacgggggaccggggcctgatcgat
gcgcagggctacctgcacctcaaggaccgcctgaaggacctggtcatcacgggcggcttc
aacgtctatcccgtggatgtggaaaacgccctgggccagcacccggccgtgcacgagtgc
gtggtcttcggcatccccgacgaccattggggcgaggccgtgcaggccgccgtgcaattg
cgcgccgaactgcgccccgaccagcggccggacgaggccgaactgatcgccttcgtgcgc
cagcgcctgggccccgtgcagacacccaagcgcatccactttcacgccagcctgccgcgc
tcgcccgtgggcaagctgctcaagacggccgtgcgcgagcttgcgctgacaccccgttga

DBGET integrated database retrieval system