KEGG   Delftia tsuruhatensis: BI380_22110Help
Entry
BI380_22110       CDS       T04496                                 

Definition
(GenBank) 4-hydroxybenzoate--CoA ligase
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4775783..4777375
Genome map
AA seq 530 aa AA seqDB search
MIDFTQPFNFAAHLFALNEGRPGKIAYIDDHGTLSYGQLQQQAQRMASGLLAAGIHREER
VLLLMHDRHEWAVAFLGALYAGVVPVAVNTLLTADDYAYMLGHSRAQAVLTCDALLPLLR
QALDRAPNEVRHVWVAGDEAAARAAGFAPLQPWLAAQPPLPAPAPTLGDDPGFWLYSSGS
TGKPKGAVHTHANPYWTAELYGGPVLGLGEGDICFSAAKLYFAYGLGNALSFPLSVGATV
LLMAERPTPEATFARWVQHRPTVFFGAPTGFAGMLASPLLPAREQVSLRMCSSAGEALPA
EIAQRFKAHFGADIVDGIGSTEMLHIFLSNRPGDIRYGTTGKPVDGYRVELRGEDGRPVA
DGEVGDLFIQGPSAALMYWGNRDKTRETFQGGWLKSGDKYVRDADGYYTYAGRSDDMLKV
SGIYVSPFEVEATLMQHPAVLEAAVIGKTDADGLLKTKSFVVLKDGCSATEAELKAFVKQ
RLAAYKYPRFIEFVDELPKTATGKIQRFRLREREASTPPEPLRGFPLSTR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacttcacccagcccttcaatttcgccgcgcacctgttcgcgctcaatgagggg
cggcccggcaagatcgcctacatcgacgaccacggcacgctgagctacggccagctgcag
cagcaggcgcagcgcatggccagcggcctgctggcggcgggcatccaccgcgaggagcgc
gtgctgctgctcatgcacgaccgccatgaatgggccgtggcctttctgggcgcactgtat
gcgggcgtggtgccggtggcggtgaacaccttgctcacggccgacgactacgcctacatg
ctgggccacagccgcgcccaggccgtgctgacctgcgatgcgctgctgcccctgctgcgc
caggcgctggaccgggcgcccaacgaggtgcgccatgtctgggtggccggcgacgaagcg
gcggcgcgcgccgcaggctttgcgcccctgcagccctggctggcggcgcagccgccgctg
cccgcaccggcgcccacgctgggcgatgacccgggcttctggctgtattcctcgggctcc
acgggcaagcccaagggcgcggtccacacgcatgccaatccgtactggacggccgaactc
tatggcggcccggtgctgggcctgggcgagggcgacatctgcttttccgccgccaagctc
tacttcgcctacggcctgggcaatgccctgagctttccgctgagcgtgggcgccaccgtg
ctgctgatggccgagcggcccacgcccgaggccaccttcgcgcgctgggtgcagcaccgg
cccacggtgttcttcggcgcgcccacgggctttgcgggcatgctggcctcgccgctgctg
cccgcgcgcgagcaggtcagcctgcgcatgtgctcctcggccggcgaggcgctgccggcc
gagatcgcccagcgcttcaaggcgcatttcggcgccgacatcgtggacggcatcggctcc
accgagatgctgcacatcttcctgtccaaccggcccggcgacatccgctacggcaccacg
ggcaagcccgtggacggctaccgcgtggagctgcgcggcgaggacggccgccccgtggcc
gatggcgaggtgggcgacctgttcatccagggccccagcgccgccctcatgtactggggc
aaccgcgacaagacgcgcgagaccttccagggcggctggctcaagagcggcgacaagtac
gtgcgcgacgccgatggctactacacctatgccgggcgcagcgacgacatgctcaaggtc
agcggcatctatgtctcgcccttcgaggtcgaggccacgctgatgcagcacccggccgtg
ctggaggccgccgtgatcggcaagaccgacgccgacggcctgctcaagaccaaatccttc
gtcgtgctcaaggacggctgcagcgccaccgaggccgagctcaaggccttcgtgaagcag
cgcctggccgcctacaagtacccgcgcttcatcgaattcgtggacgaacttcccaagacc
gccaccggaaagatccagcgtttcaggcttcgagagcgcgaagccagtacaccccctgag
ccgctacgcggcttccccctctctactcgctga

DBGET integrated database retrieval system