KEGG   Delftia tsuruhatensis: BI380_32195Help
Entry
BI380_32195       CDS       T04496                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7056099..7061414
Genome map
AA seq 1771 aa AA seqDB search
MLSGQSAIAAAGRAPASLVEHLSGLAQQRPDDIWLTVAAVQDGRVVERSHSYGEFDRRVR
ALATRLQQLCPVGARALVMMDNDEHYAASMLACFYAGVIAVPVPPLESLRVQHLERLLGI
VGDADAACVISTAEVMQALPGADARFGSIAAVAADQVDLADAEAWRPHAPAADDIAFLQY
TSGSTSAPKGVMVSHGNLIANEAAIQQRMDIGAGDRFMSWAPLYHDMGLIGGLLQPLYSG
LPLVLTSPRLFLESPVRWLELISRHRATISGGPDFAYRMCLERIKPSQLAQLDLSSWRLA
YTGAEPVRADTVTAFAQRFAACGLRPDAAYACYGLAEATLFITGGSCGAGATITSFDTEA
LGQGRAVESPGASQTTALVGCGPAVPGHAVAIVDPHSLQVLEPGRVGEIWAHGPSISQGY
WGKPQQTQQAFVEHAGRRWLRTGDLGFVHAGQVHVAGRIKDLIIVRGHNLYPQDIERVVE
AEVEAVRKGRVAAFAVDIDGREGIGIAAEVSFGMQKLVPAQALVDALSTAVGAQCGEAPR
VIVLLNPGALPRTSSGKLQRTACRQGWSARTLDAWAVFESGRFAGGGSQAPQEAGAADPT
TGTLAGLWREVLGGDAQHGPAGEANFFAQGGNSLAAVRLAARICRQWSLAYPAGRVFEHP
RLRDQAQDIDRLCQQRQPGTALQRIAPLAEARRAMPLPLTPAQQRQWFLWKMDTRSTAYH
VQGALRITGPLDAGALRAAVQGLAERHGSLRTVFNARPDGEVEQRLDPQGTLELQWLDAA
QAAQREEHAAQWLQALCAQPFDLRQGPLARAGLVRLQAHEHILALVMHHIVSDGASMQIL
LDDLAALYAGAPDSGPALQYVDYAVWQREQAQQAQQGQQASLAYWLERLQVPPGEAQPVL
ALPTDHPRQALARYRAGRHGFELPGATLQALRAQARQQADTLFTLLLAGWQALLYRYTGQ
EDIRVGVPVANRAHADLQGVVGFFVNTLVLRNRIDGRMRLSEVLQQAREAAQGAQAHHAL
PFEQLVEALQPQRSLAHSPLFQVLFNHLVEDWQALQQVPGWTVAGQPLAAADAQFELTVE
VRERSDGGLGISLVYARELFEPGSMQRLAAHYAAMLEALARQPQCAVDEVPLLSPEERQQ
LAAWSCNDQVLHGGDIVHRRFEQQVARSPDAPALCLGEATLGYSELNARANRLAHHLIAS
GVRPGVPVGIAMERSIEMVVGLLAIMKAGAAYVPIDPEHPADRIAYMLEDSGVSLVLVQP
QVRGRLPANCSARLVDVPGLASRLQDLPAHNPAVALHGDSLVYVIYTSGSTGRPKGAANR
HRSLCNRLAWGQMHQPLGPGDTVLQKTPFGFDISFWEFFWPLTTGARLALAAPGDHRDPR
RLAELIARHQVSTIHFVPSMLQAFMAHPAAATCQGLQRIVCSGEALSAELQAAVLQAFPG
TRLLNLYGPTEAAIEVTWWDCRDEGALSVPIGRPVAGLRTHVLDAALNEVPRGVAGELYL
GGVGLARGYWRRPGLSAERFVADPASRTGERLYRTGDLVRWRGDGQIDYLGRVDHQVKIR
GFRIELAEVEAQLLAHPAVREAVVVARQAADGARLAAFVSVQQGQTLDMAALRSALAAAL
PDYMLPSSITVLDALPLNANGKVDRKALPEAPTLPALEHQAYEPPEGGVAVTIAALWAQV
LGVERIGASDNFFDLGGHSLQLIRVHGLLEARLGRELSLVDLFKHPTVSALARRIEQGAD
GEGDGARDGMDAAQRRREALLQRKRHIERTL
NT seq 5316 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtggacaaagtgcaatcgcggcagcaggccgggcgccggccagcctggtcgag
catctgagtgggctggcgcagcagcggcccgacgacatctggctcaccgtggccgccgtg
caggacggccgcgtggtcgagcgcagccacagctatggcgagttcgaccgccgcgtgcgt
gcgctggccacccggctgcagcagctgtgccccgtgggcgcgcgcgccctggtgatgatg
gacaacgacgagcactacgccgccagcatgctggcctgcttctacgcgggcgtgatcgcc
gtgccggtgccgccgctggaatcgctgcgcgtgcagcacctggagcggctgctgggcatc
gtgggcgacgcggatgcggcctgcgtgatcagcacggccgaagtgatgcaggccctgccc
ggcgccgatgcgcgctttggcagcattgccgccgtggccgccgaccaggtggacctggcc
gatgccgaggcctggcggccccatgcgccggctgccgacgacatcgccttcctgcaatac
acctcgggctccacctcggcgcccaagggcgtgatggtcagccacggcaacctcatcgcc
aacgaggccgccatccagcagcgcatggacatcggcgcgggcgaccgcttcatgtcctgg
gcaccgctgtaccacgacatgggcctgatcggcggcctgctgcagccgctgtacagcggg
ctgccgctggtgctgacctcgccgcgcctcttcctggaaagccccgtgcgctggctggag
ctgatctcgcgccaccgcgccaccatcagcggcggccccgacttcgcctaccgcatgtgc
ctggagcgcatcaagccgtcgcagctggcgcagctggacctgtcgagctggcggctggcc
tacaccggcgccgagcccgtgcgtgccgacaccgtcacggccttcgcgcagcgctttgcc
gcctgcggcctgcggcccgacgcggcctatgcctgctacggcctggccgaggccaccctg
ttcatcaccggcggcagttgcggcgcgggcgccacgatcacgtccttcgataccgaggcc
ctgggccagggccgggccgtggaaagccccggcgcctcgcagaccaccgcgctggtgggc
tgcggccccgccgttcccggccatgccgtggccatcgtcgatccgcacagcctgcaggtg
ctggagcccggccgcgtgggcgagatctgggcgcacggccccagcatcagccagggctac
tggggcaagccgcagcaaacgcagcaggcctttgtcgagcatgcaggccggcgctggctg
cgcacgggcgacctgggcttcgtgcatgctgggcaggtccatgtggcgggccgcatcaag
gacctgatcatcgtgcgcgggcacaacctctacccgcaggacatcgagcgcgtggtcgag
gccgaggtcgaagccgtgcgcaagggacgcgtggccgcgtttgcggtggacatcgatggc
cgggaaggcataggcattgctgccgaagtctcgttcggcatgcaaaaactggtgccggcc
caggccctggtcgatgccctgagcaccgccgtgggcgcgcagtgcggcgaggcaccccgg
gtgatcgtgctgctcaaccccggcgccttgccccgcacctccagcggcaagctgcagcgc
acagcctgccgccagggctggtccgcgcgcacgctggatgcctgggccgtgttcgagtcg
ggccgcttcgcgggcggcggcagccaggcaccgcaggaggcgggcgcggcagatcccacc
acaggcacgctggccggcctgtggcgcgaggtgctcggtggcgatgcccagcacgggccg
gccggcgaggccaacttcttcgcgcaaggcggcaactccctggccgccgtgcggctggcc
gcgcgcatctgccggcaatggtccctggcgtatccggccgggcgggtcttcgagcacccg
cggctgcgcgaccaggcgcaggacatcgaccggctgtgccaacagcgccagccgggcacg
gcgctgcagcgcattgccccgctggccgaggcccgtcgcgccatgcccctgccgctgacg
ccggcccagcagcgccaatggtttctctggaagatggatacgcgcagcacggcctaccac
gtgcagggcgccctgcgcatcaccgggccgctggatgcaggcgccctgcgtgcggccgtg
cagggcctggccgaaaggcacggttcgctgcgcacggtattcaacgcccggcccgatggg
gaggtcgagcagcgcctggacccccagggcacgctggagctgcagtggctggatgccgcg
caggccgcgcagcgcgaggagcacgccgcccaatggctgcaggcgctgtgcgcccagccc
tttgatctgcggcaggggccgctggcccgggctggcctggtgcggctgcaggcccatgag
cacatcctggcgctggtgatgcaccacatcgtctccgacggcgcctccatgcagatcctg
ctggacgatctggcggcgctgtatgccggcgccccggacagcggcccggcgctgcagtac
gtggactacgccgtctggcagcgggagcaggctcaacaggctcagcaaggccagcaggcc
tcgctggcctactggctggaacggttgcaggtgcccccaggcgaggcccagcctgtgctg
gccctgcctaccgaccatccgcgccaggcgctggcacgctatcgggcgggacggcacggc
ttcgagctgcccggcgcgaccttgcaggcactgcgcgcgcaggcccgccagcaggcagac
acgctcttcacgctgctgctggcaggatggcaggcactgctgtaccgctacacgggccag
gaggacatccgcgtcggcgtgcccgtagccaaccgcgcgcatgccgacctgcagggcgtg
gtcggctttttcgtcaacaccctggtgctgcgcaaccgcatcgacgggcgcatgcgcctg
tccgaggtgctgcagcaggcccgcgaggcggcgcagggcgcccaggcccaccacgcgctg
ccgttcgagcagctggtggaggcgctgcagccgcagcgcagcctggcgcacagccccttg
ttccaggtgctgttcaaccatctggtggaggactggcaggcgctgcagcaggtgccgggc
tggaccgtggccggccagccgctggcggccgcagatgcgcagttcgagctgaccgtggaa
gtgcgcgagcgctccgatggcggcctgggcatcagcctggtctatgcccgcgagctgttc
gagccgggcagcatgcagcgcctggccgcccactatgcggccatgctggaggccctcgcc
cggcagccccaatgtgccgtggacgaggtgccgctgctgagtcccgaagaacgccagcaa
ctggcggcttggagctgcaatgaccaggtcctgcacggcggcgacatcgtgcaccgccgc
ttcgagcagcaggtggcgcgcagccccgatgccccggccctgtgcctgggcgaggccacg
ctgggctactccgagctcaatgcgcgcgccaaccggctggcgcatcacctgatcgcatcg
ggcgtgcggcccggcgtgccggtgggcattgccatggagcgctccatcgagatggtcgtg
gggctgctggccatcatgaaggccggcgcggcctatgtgcccatcgaccccgagcatccg
gccgaccgcatcgcctacatgctggaggacagcggcgtgtccctggtgctggtgcagccg
caggtgcgtggccgcctgccggccaactgcagtgcccgactggtcgatgtgccgggcctg
gcgtcccggctgcaggacctgcctgcgcacaacccggccgttgccctgcatggcgacagc
ctggtctatgtgatctacacctcgggctccacgggccggcccaagggcgcggccaaccgc
caccgttcgctgtgcaaccgcctggcctgggggcagatgcaccagccgctgggcccgggc
gatacggtgctgcagaaaacgcccttcggcttcgacatctccttctgggagttcttctgg
ccgctgaccaccggcgcacgcctggcgctggccgcccccggcgaccaccgcgatccccgg
cgcctggccgagctgatagcgcgccaccaggtcagcaccatccacttcgtgccgtccatg
ctgcaggccttcatggcgcacccggcggccgccacctgccaggggctgcagcgcatcgtg
tgcagcggcgaggccctgtccgccgaattgcaggcggccgtgctgcaggccttccccggc
acccgcctgctcaatctctacggccccacggaggcggccatcgaggtcacctggtgggac
tgccgggacgagggcgcgttgtccgtgcccataggccgccccgtggccgggctgcgtacc
catgtgctggatgccgcgctcaacgaggtgccgcgcggcgtggccggcgagctgtatctg
ggcggtgtgggcctggcgcgcggctactggcggcggcctggcctgagcgccgagcgcttt
gtcgccgaccccgccagccgcacgggcgagcgcctgtaccgcacgggcgacctggtgcgc
tggcgcggcgacggccagatcgactacctgggccgcgtggaccaccaggtgaagatccgc
ggctttcgcatcgagctggccgaggtggaggcgcaactgctggcccaccccgccgtgcgc
gaggccgtggtggtcgcccgccaggcggccgacggcgcgcggctggccgcctttgtctcg
gtgcagcaggggcagaccctggacatggccgcgctgcgcagcgcgctggccgcagccctg
cccgactacatgctgccctcgtccatcaccgtgctggatgccttgccgctgaacgccaat
ggcaaggtggaccgcaaggcgctgcccgaggcgcccaccctgccggccctggagcaccag
gcctacgagccgcccgagggcggcgtggccgtgaccattgccgccctctgggcccaggtg
ctgggcgtggagcgcataggcgccagcgacaacttcttcgacctgggcgggcattcgctg
cagctcatccgcgtgcatggcctgctggaggcgcggctgggccgggagctgtccctggtc
gatctcttcaagcaccccacggtgtcggccctggcgcggcgcatcgagcaaggagcagat
ggcgagggcgacggcgcccgggacggcatggacgcggcccagcgccgccgcgaggcgctg
ctgcagcgcaagcgccacatcgaaaggaccctctga

DBGET integrated database retrieval system