KEGG   Delftia tsuruhatensis: BI380_32215Help
Entry
BI380_32215       CDS       T04496                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7076050..7093947
Genome map
AA seq 5965 aa AA seqDB search
MDRGRLRQIAERFASLSPAQRTLALQKIRAEGLDLSHFPIPVRAPSPDQTEALSHAQLRQ
WFLWKLDPQSSAYHIAQASWMHGELDLAALRQAFGVLLERHGGLRTVFEESPDGLARQRI
VPQLALELPLIDLSSLPAAQRRERALAEAERLCLTPFDLTRGPLLRVAAVRLDSRQHLLV
VVMHHIISDGRSMQILLEEFAGLYAALVQQRPTRLPPLPIAYTDYAAWQRDWLEAGERQR
LLDYWLPELAGGQDLHLELPADHARAPGAETRWHAAWHRLELPTSLVAGLEQRAREQGTS
LFVALLAGFQALLHRYTAETDIRVGVPVANRNQPEAEPLVGFFVNTLVMRGRLDPRMRLQ
ELLAQLAERVRLGLAHQDLPYEQLVEALQPRRSLDGSSLFQVMLNYQHEEAAGLAGLEIQ
KLELDGLAAQFELTLHASRRADGSLQLGFAYARERFEPATVQRMGAHLSLLLQALAHAPQ
CALDQVQLLPGDEQAQLLDRSARRSTRNGPALNPAQPACLHQRFATSAQQRPDAVALTCE
SARLTYAELDAQANRLARRLIALGVRPETRVGIAMQRSVEMVVGLLAILKAGGAYVPLDP
DYPADRLAHMVADSGISLVLTQAVVRERLPGAAALQVLEIDLLDLSGEPDTDPQVDVSPD
SLAYVIYTSGSTGRPKGAQLSHRNVARLLDATDAWFGFGPDDVWTLFHSYAFDFSVWEIF
GALCTGGRLVVVPYWVSRSPQDFLALLRAECVTVLNQTPSAFGQLVHAVEQDEEGGSGLA
LRQVIFGGEALEPESLRPWFDRFGDESPQLINMYGITETTVHVTYRQITKADLDGGRSPV
GVAIPDLGLYVLDGSLNLLPQGVAGELYVAGEGLARGYLNRQGLTAERFVANPFSETGER
LYRTGDLVRWSAQGELEYLGRADQQVKIRGFRIELGEVQSQLLAQPEVREAVVLAKEGAR
LIAYVSLRDAVEESQIKQRLGHALPDYMVPSAIVVLDALPLTANGKVDRKALPEPEMVSA
QQYEAPQGELEETLAQIWAEVLGVERVGRQDGFFELGGHSLLALGLLERVRAQGLRVQVR
TLFQHPRLAEFAQAVLEEQQEQQGEQGEEVAGEIDVPPNGIPEGCTAITPDMLTLVALDE
EEIARIAQAVPGGAANIQDIYPLAPLQEGILFHHLLQSEGDAYVTSHTLSFDSRERLQRF
AESFDQVVARHDILRTAVFWEGLATPVQVVCRQARLPLSWLEEGGTAAPSQDALARLAAC
AHGYRIDLRKAPLIHLVAAHDAPGQRWLLQILAHHMVDDNTTLKQVIGEIALIQQGRSSA
LPRPLPFRQFVAQARSGEGMAGHEAFFRTMLGDVQEPTAPFGLLDVQGDGARTNEVRQVL
DGGLAARLRQQSRRHGVSAAALFHLAWALVLARTSGRDDVVFGTVLFGRMQAQQGAARAL
GMFINTLPLRVRLAGCGVAQALRQTQSALTDLLHHEHASLSMAQSCSGLAGGAPLFTALL
NYRHTALQDADAGDAWSGVQILQSHERTNFPFGLSVNDTGEGFTLIAHVIDAVNAHSMCG
YMHEALDGLADALARDPGQPVTAIAVLPAHERDRLLQWSLNGKSHPEALPVHREFEARVR
EQPDAVCLVHGDEALTSARLNARANRLAHRLMALGVGPDVRVGVALERSVDMVAGLLAVL
KAGGAYVPLDMEYPVDRLAYIAQDSGIALLLTERKARQRLPFAQALNVVELDDLDLDAGP
DHNPGVAVHGDHLAYVIYTSGSTGRPKGAANRHAALSNCMAWMQDHYRLTRADAVLHKAA
FGFDVSAWEIFWPLTAGVRLVVARPGDHRDPERIVALIRRHQITTLNFVPAMLQAFLAHE
GIEEETRLRYVICGGEAMPAETQREALRRLHGVSLQNLYGPTEAAIHVTHWTCRDDGRSP
VPIGRPVSATKALVLGQDLGLVPAGVAGELYLGGQALAQGYLGRPGLSAERFVADPFDQG
GGRLYRTGDLVRWNDEGQLEYLGRLDHQVKIRGFRIELGEIEARLLAQPQVRESVVVARK
GSAGMHLAAYVSAHEGQQVTAAELRERLALELPDYMVPAAIMVLDRLPLNANGKVDRAAL
PEPELLASLHYEAPVGDGEQRLAALWSEVLGVERVGRHDHFFELGGHSLLALKLLERMRA
QGWVTQVRTLFQHPRLADLALALRREQGLPRHEVQVPPNGIPEGCTAITPDMLTLVAMDA
QQIARVEAAVPGGAANIQDIYPLAPLQEGILFHHTLHQQGDAYATPTLLGFDTRERLLGF
VQRLNQVIARHDILRTAVLWEGLAEPVQVVCRQAQVLLDWLEPGESEGEGEGEGEGDVAA
VLQKRLDPRVQRIDVRRAPMIRAVAAQDAPNGRWLLQLLTHHLVLDHTTLERIVEEIALM
AQGREAELPRPLPFRRFVAQARLGVSTSEHEDFFRAMLGDVDEPTAPFGLLDVQGDGSAV
EEARLALDAPLSRELRRQAQRHGVSAASLFHLAWALVLGRTTGKDDVVFGSVLFGRMQGG
EGAHSALGMFINTLPLRIRLGGRLGGRSVQDCLRQTHELLTGLMHHEHATLSLAQRCSAL
AGGTPLFSALLNYRYSVAPQEGAAAGAWEGMTALGGQERTNYPVTVSIDDLGEGFGIVAQ
ADAALGAERLCGYMASAVASLVHALESEPGLEAAALDMLDGKEWAQLQAWSLGARTEPGM
QPVHRLIERQAQARPDAVALVFGDQVLSYDQLNRRANQLAHRLMALGVRPETRVGIAMER
SIEMVVGLLAIMKAGGAYVPLDPDHPPERLAQMIEDGAVRRLLTHSALRERLPAGEDLQW
LDIDRIDLAGESQRNPVVAVHGEHLAYVIFTSGSTGRPKGAANRHAALHNRLAWMQQAYA
LDASDAVLQKTPFSFDVSVWEFFWPLMVGARLVMAAPGDHRDPARLVALITGHGVTTVHF
VPSMLQAFVAHAGVAACTGLRRILCSGEALSAEAQNAVFRLLPGAGLYNLYGPTEAAIDV
THWRCRDDGRRQVPIGRPISGIRTYVLDCAMRPAPQGVAGELYLGGMGLARGYLNRPALT
AERFVADPLDTQGGLLYRTGDLVRWNGDGQIEYLGRLDHQVKIRGLRIELGEIEAHLLAQ
PGVREAVVVAAQATSGAAGARLVAYVAGPDADAGLAETLRQALAGRLPDYMQPSAIVVLP
ALALNANGKVDRKALPQPEWAQRGYEPPHNGVEQQLSAIWAELLGQDRVGRRDNFFELGG
HSLLAMGMLERMRAHGLSASVRSLFQHPQLADFAAQLMQADGAAQVQVPPNGIPEGCTAI
TPAMLALVALDVQEIARVEAAGPGGAANIQDIYPLAPLQEGILFHHTLHQQGDAYATPTL
LGFDTRERLLGFVQRLNRVIARHDILRTAVLWEGLAEPVQVVCRQAQVLLDWLEPGESEG
EGDVAAVLQKRLDPRVQRIDVRRAPMIRAVAAQDARNGRWLLQLLTHHLVLDHTTLERIV
EEIALMAQGREAELPRPLPFRRFVAQARLGVSTSEHEDFFRAMLGDVDEPTAPFGLLDVQ
GDGSAVEEARLALDAPLSRELRRQAQRHGVSAASLFHLAWALVLGRTTGKDDVVFGTVLF
GRMQGGEGAHSALGMFINTLPLRIRLGGRSVQECLHETHAGLTGLMHHEHATLSLAQRCS
ALAGVTPLFSALLNYRYSVAPQEGAAADAGSGAWEGMTALGGQERTNYPVDMSIDDLGQG
FRLVGQASKTVGAQRLCAYMLAAVEGIVAALAETPALPACDIELLDRDEWALLAQWAQSG
QSGCNPPRRDAQPLVHRLFEQQVDGRPQATALVFGDECISYAQLNRRANRLAHRLIAEGV
GAEVRVGIAVERSVEMVVAVLAVLKSGAAYVPLDPGYPAERLAHMVEDSGMACLLTQSRL
GLEVAGRVKALDLDAIGAMPGPDHNPGAAVHGECLAYVIYTSGSTGRPKGVGISHRCLAE
QAQLAVGFAALSPQDRVLQFATLNFDGCIEQLFAPLVAGAAMVLRGPELWDSATFHRELM
ARQISVADLTTAYWLLLVQDFARQGLRGYGRLRQVHVGGEAMPGAGLKAWRDAGLGHVRL
LNAYGPTEATVTASLFDCTGLVEGAGAAPQDLPIGRPLAGRHMWVVDDRMRPVPLGVAGE
LCIGGPLLSRGYLNRAGLSAERFVADPFGRDGARLYRTGDLVRWNAQGQLEYLGRVDHQV
KIRGLRIELGEVQAQLLALDDVREAVVVAGEGPAGTRLLAYVSARSGRTLDGQEMRERLA
TVLPDYMVPGAIMVLDQLPQNANGKLDRQALPAFGMPAASQAPEGELEALLARIWAEVLG
LERVGRSDNFFALGGDSILSLQIVSRLRRFGWKLSPRQLFERQSIAELARVAEPVQDEAV
QQDTPVQGSVPLLPIQAEFFETDVPQRSHWNQALLLRSTQPLQPAPLRQALADLLARHDS
LRLRFRLTAQGAWEQAYASPSEADLQALLWVRQARDAGAIEALCEQAQRSLDIVHGPLLR
GLCIEVGDGSWRLLLVAHHLVVDGVSWRILLEDLRSAYASRLQGLEPARVHKTASYQRWS
QALQAHAAQCGGELAFWQALAQVPAVLPCARPGGANTLAWQSSVELRLDRERTEALISRV
PAAYRTQINDILLAALGRALCAWSGQQRILVDLEGHGREELSAGVDVSRTVGWFTSVFPV
ALDAGTGPGDAIKRVKQSLREVPLHGLGHGVLKYLGTAQQRQAMQALPQASLVFNYLGQF
DASFDSAAQWLPAAEGSGMPADASAPLSHEFTINGRVYDGELVMTAAFSTARHDTADVQA
WMGRYRQELEGLIDHCLSGAQGVTPSDFPLARVTQAQLDGLDLPAGNLADLYPLSPMQSG
MLFHSLSDPSGLSYVTQLRIDAHGLDAARFRKAWQAVLDRHAVLRSGFLADASLPLQWVA
RQVLLDITEHDCRHSEDVAGALDALAAGQFAAFDLSKPPLMRLALVRVSDGSHHCIWTAH
HLLTDGWSSSSLLGEVLRDYKGIAVEPVDTSYRDYIAWLQGLDHGASEAYWRRLVQPLHE
PTLLVDALARPAVRPGALPAARQGHHEAGAALDAGATQQLVEFAQRERVTANTLVQAAWS
LVLARYTGQATVAFGATVAGRPPELAGVERMQGLFINTLPVVVACDGALELGPWLRTLQA
QNLASREHEQTSLSDIQRWAGKGQRGLFDSILVFENYPMDAVLSAHDDPHLRFAVTHAID
VTSYPMDLEVRLGDVLSLKMIYQRSSFGDDAVQALLRQLVQVLASMAGEGVHCLRDIALL
PEPGRDGPAGTGTGMGTDACRPPFLPVHACMALQARRDPGAVALVMGEQTISHGELQARS
NHFANRLVQAGVGRGAIVGIAMERSLEMVICLLSVLKAGAAYLPLDPASPAERQRFMLAD
SGASHLIAHRAALHKLGTPAVAHLVVAEEVDFTQACNAAPAHAVHERDLAYVIYTSGSTG
QPKGVVVEHGPLSMHCAATAGIYGMRANSRELHFMSFSFDGAHERWLTALSIGAGLVLRE
PQMWTAEQACEALRHHGISNAAFPPAYLAQIADWAAEQSQEPPPVELYVFGGEAMPKAAY
DKVRQSLRPRLLINGYGPTETVVTPLIWKAEASETFDCAYAPIGRPVGERTVHILDADLH
RVPHGVVGELYIGGYGLARGYLSRHGLTAERFVADPFDGGGGRLYRTGDLVREMPGGNIE
YIGRADHQVKIRGFRIELGEVEKAVRAVPGVVDAAVLVQDAGTGKQLVAYVVGGRARPRS
PWSSASASRQASTCPTTCCRPIRWSCPPCQDWSAASSTVVRCRCRRQMPGGFTCHRPQRR
PWRWPASGRRCLAWNAWARPTTSSNWAGTPCSASGCTPRCASWAIRSWTSSCATCCSGPP
LPACWSFAQPAPVELGASWRSTPCVRLRHRCFACMPGSARCLTTSRWRGPCRTGAPSTPY
PAAAWAIPATATARWSRWPTTTARW
NT seq 17898 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtggccgcctgcgccaaatcgccgagcgctttgcaagcctgagccctgcccag
cgcacgctggcattgcaaaagatccgggccgagggactggatctctcgcatttccccatc
ccggtgcgcgcaccatcgcccgaccagaccgaagccctgtcccatgcgcagctgcgccag
tggttcctgtggaagctggacccgcaaagctcggcctaccacatcgcccaggcctcgtgg
atgcatggcgagctggatctggcggccttgcggcaggcgttcggcgtgctgctggagcgc
cacggcggactgcgcacggtgtttgaggaaagccccgacggcctggcgcggcagcgcatc
gtgccgcagctggccctggagctgccgctgatcgacctcagctccctgcctgcagcacag
cggcgcgaacgggccctggccgaagccgagcgcctgtgcctcacgccctttgacctgacg
cgcggcccgctgctgcgcgtggccgccgtccgcctggacagccgccagcacctgctggtg
gtggtgatgcaccacatcatctccgacggccgctccatgcagatcctgctggaggaattc
gccggcctgtacgcggcactggtgcagcagcgcccgacccgcctgccgccgctgcccatt
gcctacaccgactacgccgcctggcagcgcgactggctggaggccggggaaaggcagcgc
ctgctggactactggctgcccgagctggccggtggtcaggacctgcatctggagctgccc
gccgaccatgcccgcgcgccgggcgccgagacccgttggcatgccgcctggcaccggctg
gagctgcccaccagcctggtggccggactggagcagcgcgcccgcgagcagggcacctcc
ctcttcgtggcgctgctggccggtttccaggccctgctgcaccgctataccgccgagacc
gatatccgcgtgggcgtgcccgtggccaaccgcaaccagcccgaggccgagccgctggtc
ggcttcttcgtcaacacgctggtgatgcgtggccggctcgatccccgcatgcgcctgcag
gagctgctggcccagctggccgagcgggtccgcctgggcctggcccaccaggacctgccc
tacgagcaactggtcgaggcactgcagccgcgccgcagcctggacggcagctcgctgttc
caggtgatgctgaactaccagcacgaagaggcggccggcctggcgggcctggagatccag
aagctggagctggacggcctggccgcccagttcgagctgaccctgcacgccagccgccgc
gccgacggcagcctgcagctgggctttgcctatgcgcgcgagcgcttcgagccggccacg
gtgcagcgcatgggcgcgcatctgtcgctgctgctgcaggcgctggcgcatgcgccgcag
tgcgcgctggaccaggtgcaactgctgcccggcgatgagcaggcgcagcttctggaccgc
agtgcgcgccgcagtacacgcaatggacctgcgctcaaccctgcgcagcccgcctgcctg
caccagcgctttgccacaagcgcgcagcaacggccggatgcggtggcgttgacctgcgag
tccgcacgactgacctacgccgaactcgacgcccaggccaaccgcctggcccgccgtctg
atcgccctgggcgtgcgccccgagacgcgcgtgggcattgccatgcagcgctcggtggag
atggtggtgggactgctggccatcctcaaggccggtggcgcctatgtgccgctggacccg
gactaccctgccgaccggctggcgcacatggtggccgacagcgggatctctctggtgctg
acgcaggctgtggtgcgtgagcgcctcccgggcgctgctgcgctgcaggtgctggagatc
gacctactggacctgtcgggcgaacccgataccgatccgcaggtcgatgtgagcccggac
agcctggcctatgtgatctacacctccggctccacgggccgtcccaagggcgcgcaactg
agccaccgcaacgtggcacggctgctggacgccaccgatgcctggttcggcttcgggcct
gacgatgtctggaccctgttccattcctatgccttcgacttctcggtctgggagatcttt
ggtgccctgtgcacgggcggccggctggtggtggtgccgtactgggtcagccgctcgccc
caggacttcctggctttgctgcgtgccgagtgcgtaacggttctcaatcaaacgccttcg
gccttcgggcagctggtgcatgcggtggagcaggatgaagaaggcggctccggcctggcg
ctgcgccaggtgatcttcggcggcgaggcgctggagcccgagagcctgcggccctggttc
gaccgcttcggtgacgagagcccgcagctcatcaacatgtacggcatcaccgagaccacg
gtgcatgtgacgtaccggcagatcaccaaggcggatttggacggaggccgcagccccgtt
ggcgtggcgattccggacctgggcctgtacgtgctcgacggcagcctgaacctgctgcct
cagggcgtggccggagagctgtacgtggcaggcgagggccttgcacggggctatctcaac
aggcaaggactgacggcagagcgcttcgttgccaacccgttcagcgagacgggcgagcgc
ctgtaccgcacgggcgacctggtgcgctggagtgcccagggcgaactcgaatacctgggc
cgtgccgaccagcaggtcaagatccggggcttccgtatcgagctgggcgaggtgcagtcg
cagctgctggcccagcccgaggtgcgcgaggcggtggtgctggccaaggagggcgcaagg
ctgatcgcctatgtctccctgcgtgacgcggtggaggaaagccagatcaagcagcgcctg
ggccatgcgctgcccgactacatggtgccctcggccatcgtcgtgctcgatgccctgccg
ctgactgccaacggcaaggtggaccgcaaggcgctgcccgagccggagatggtcagcgcc
cagcaatacgaggcaccgcagggagagctggaggaaacgctggcgcagatctgggccgag
gtgctgggcgtggagcgcgtgggccggcaggacggcttcttcgagctgggtgggcattcg
ctgctggccctgggcctgctggagcgtgtgcgcgcccagggcctgcgcgtgcaggtgcgc
acgctgttccagcatccgaggctggcggagtttgcgcaggcggtactggaggaacagcag
gagcagcagggtgagcaaggggaggaggtggccggcgagatcgatgtgccacccaacggc
atccccgaaggctgcacggcgatcacgccggacatgctgaccctggtggcgctggatgag
gaggagattgctcgcattgcgcaggcggtgcccggtggcgcagccaatatccaggacatc
tacccgctggcgccgctgcaggagggaattctgttccaccacctgctgcagtccgagggc
gatgcctatgtcacctcgcacacgctgagcttcgactcgcgcgagcggctgcagcggttt
gccgagagctttgaccaggtggtcgcgcggcatgacatcctgcgcacggccgtgttctgg
gagggcctggcgacgcccgtgcaggtcgtctgccggcaggcccgcctgccgctgtcctgg
ctggaggagggcggaacagcggcaccatcgcaggacgcgctggcccggctggccgcctgc
gcccacggctaccgcatcgacctgcgcaaggcgccgctgatccacctggtggccgcgcac
gacgcgccgggccagcgctggctgctgcagatcctggcccaccacatggtggacgacaac
accacgctcaagcaggtgatcggcgagatcgcgctgatccagcagggccgctccagcgcg
ctgccccggccgctgccgttccgccagttcgtggcccaggcgcgctcgggcgagggcatg
gccgggcatgaggcgtttttccgcaccatgctgggcgatgtgcaggagcccacggcgccc
ttcgggctgctggatgtccagggcgacggagcgcgcacgaacgaggtgcggcaggtgctt
gacggcggccttgccgcccggttgcggcagcagtcccggcgccacggcgtcagcgccgcc
gcgctgttccacctggcctgggccctggtgctggccaggaccagcggtagggacgacgtg
gtgttcggcaccgtgctgtttggccgcatgcaggcgcagcagggcgcggcccgcgcgctg
ggcatgttcatcaatacgctgccgctgcgcgttcgcctggccggatgtggcgtggcccag
gccctgcgccagacccagtccgcgctgacggacctgctgcaccacgagcatgccagcctg
tcgatggcccagtcctgcagcggcctggccggcggggcgccgctgttcacggccctgctc
aactaccggcacacggcgctgcaggacgcggacgccggcgatgcctggagcggcgtgcag
atactgcaaagccacgagcgcaccaacttcccgttcggcctgtcggtcaacgacacgggc
gagggcttcacgctgatcgcgcatgtgatcgatgcggtgaatgcccacagcatgtgcggc
tacatgcacgaggcgctggacggcctggccgatgccctggcgcgcgaccccggccagccc
gtgaccgcgattgcggtgctgcccgcgcatgaacgggacaggctgctgcagtggagcctc
aatggcaagtcccatcccgaggccctgcccgtgcaccgggaattcgaggcccgcgtgcgg
gagcagcccgatgccgtctgcctggtccatggcgacgaggcgctgacctcggcccggctc
aacgcccgggccaaccggctggcccaccggctgatggccctgggcgtggggccggacgtg
cgcgtgggcgttgcgctggagcgctcggtggacatggtggccgggctgctggcggtgctc
aaggccggcggcgcctacgtgccgctggacatggagtacccggtggaccgcctggcctac
attgcccaggacagcggcattgccctgctgctgaccgagcgcaaggcacgccagcgcctg
ccgttcgcgcaggcgctgaacgtggtcgagctcgacgatctggacctggacgcggggcct
gaccacaatcccggcgtggcggtccatggcgaccatctggcctatgtgatctacacctcg
ggctccaccggccggcccaagggggcggccaaccggcatgccgcgctgtccaattgcatg
gcctggatgcaggaccactaccggctcacgcgggccgacgcggtgctgcacaaggcggcc
ttcggcttcgatgtctcggcctgggaaatcttctggccgctgacggcgggcgtgcgcctg
gtggtggcccggcccggcgaccaccgcgatcccgagcgcatcgtcgcgctgatccgccgc
caccagatcaccacgctgaacttcgtgccggccatgctgcaggcgtttctggcccatgag
ggcatcgaggaggagacccgcctgcgctatgtgatctgcggcggcgaggccatgccggcc
gagacacagcgtgaggccctgcgccgcctgcacggcgtcagcctgcaaaacctctatggc
cccaccgaggccgccatccacgtgacgcactggacctgccgcgacgatggccgcagcccg
gtccccatcggccgccccgtcagcgcgaccaaggccctggtgctgggccaggatctggga
ctggttcccgcaggcgtggccggcgaactctatctgggcgggcaggcgctggcgcagggc
tacctgggccggcccggcctgagcgccgagcgcttcgtcgccgacccgttcgaccagggc
ggcggccgcctgtaccgcacgggcgacctggtgcgctggaacgacgaaggccagctggag
tacctggggcgcctggaccaccaggtgaagatccggggctttcgcatcgagctgggcgag
atcgaggcccggctgctggcccagccccaggtgcgggagtccgtggtcgtggcccgcaag
ggctctgccggaatgcacctggcggcctatgtctcggcgcatgaagggcagcaggtcacg
gcggccgaactgcgcgagcgcctggcccttgaactgccggactacatggtgccggccgcc
atcatggtgctggaccgccttcccctgaatgccaatggcaaggtggacagggccgccttg
cccgagcctgaactgctggccagcctgcactacgaggcgcccgtgggcgacggcgagcag
cggctggccgcactctggagcgaggtgctgggcgtggagcgcgtggggcgccacgaccat
ttctttgagctgggcgggcactcgctgctggccctgaagctgctggagcgcatgcgcgcc
cagggctgggtgacgcaggtgcgcacgctgttccagcacccccggctggcggatctggcg
ctggcgctgcgccgcgagcagggcctgccccggcatgaggtgcaggtgccgcccaacggc
attcccgaaggctgcacggccatcacgcccgacatgctgacgctggtggcgatggacgcg
cagcagatcgcgcgggtcgaggccgccgtgcccggtggcgcggccaacatccaggacatc
tatccgctggcgccgctgcaggaaggcattctgttccaccacacgctgcaccagcagggc
gacgcctatgccacgcccacgctgctgggctttgacacgcgggagcgtttgctgggcttt
gtgcaacggctcaaccaggtcatcgcacgccacgacatcctgcgcacggccgtgctgtgg
gaggggttggccgagcctgtgcaggtggtgtgccggcaggcgcaggtgctgctcgactgg
ctggagcctggtgaaagcgagggcgagggcgagggcgagggcgaaggcgatgtggccgcc
gtgctgcagaagcgcctggacccgcgcgtgcagcgcatcgatgtgcgccgtgcacccatg
atccgcgccgtggcggcgcaggatgcgcccaacgggcgctggctgctgcagctgctgacc
caccatctggtgctggaccacacgacgctggagcgcatcgtcgaggagatcgcgctgatg
gcccagggccgcgaggcggagctgcccaggcccctgccgttcaggcgcttcgtggcccag
gcccggctgggcgtgagcaccagcgagcatgaggacttcttccgcgccatgctcggcgat
gtggatgagcctacggcgccgtttggcctgctggatgtgcagggagacggcagtgcggtg
gaggaggccaggcttgcgctggatgcaccgctgtcgcgcgagctgcggcggcaggcgcag
cgccatggggtgagtgcagccagcctgttccacctggcctgggcgctggtgctgggcagg
accacgggcaaggacgacgtggtgttcggctccgtgctctttggccgcatgcagggcggg
gagggagcgcacagtgcgctgggcatgttcatcaacacgctgccgctgcgcatacggttg
ggcggtcggctgggcgggcgcagcgtgcaggactgcctgcgccagacgcatgaactgctg
acggggctgatgcaccacgagcacgccacgctgtcgctggcgcagcgctgcagcgctctg
gcgggggggacgccgctgttctcggccctgctcaactaccgctacagcgtggccccgcag
gagggggccgcagcgggcgcgtgggaaggcatgacggcgctgggcggacaggagcgcacc
aactaccccgtgaccgtgtccatcgatgacctgggcgaaggctttggcatcgtggcccag
gccgatgctgctctgggggctgaacggctgtgtggatacatggcgtcggccgtggcctcc
ctggtccacgcgctggaaagcgagcccggcctggaggctgcggcgctggacatgctggac
ggcaaggaatgggcgcagctgcaggcctggagcctgggcgcccgaaccgaaccagggatg
cagcctgtgcaccggttgatcgagcgccaggcccaggcacggccggacgccgtggcgctg
gtctttggcgatcaggtgctgagctacgaccagctcaaccgccgcgccaaccagctggca
caccggctgatggccctgggcgtgaggccggagacccgggtgggcatcgccatggagcgg
tccatcgagatggtggtgggcctgctggccatcatgaaggccggtggcgcctatgtgccc
ctggaccccgatcacccgcccgaacggctggcgcagatgatcgaagacggcgccgtgcgg
cgcctgctcacccacagcgcgctgcgcgagcgcctgcccgcaggcgaggatctgcagtgg
ctggacatcgaccgcatcgatctggccggtgaatctcagcgcaaccccgtggttgccgtg
catggggagcatctggcctatgtgatattcacctcgggctccacgggccgccccaagggc
gcggccaaccggcatgcggccctgcacaaccggctggcctggatgcagcaggcctatgcg
ctcgatgcctcggacgccgtgctgcaaaagacaccgttcagcttcgatgtgtcggtctgg
gagttcttctggcccctgatggtcggcgcccggctggtgatggccgcgcctggcgatcac
cgtgaccccgcaaggctggtggcgctgatcacgggccatggcgtcaccaccgtgcacttc
gtgccttccatgctgcaggcctttgtggcgcacgcgggcgttgcagcatgcacgggcctc
aggcgcatcctgtgcagcggcgaggccctgtcggccgaggcgcagaacgccgtcttcagg
ttgctgcccggagccggtctctacaacctctatggcccgaccgaggcggccatcgacgtc
acccactggcgctgccgcgacgacgggcggcgccaggttcccatcggccggcccatcagc
ggtatccgcacctatgtgctggactgcgccatgcggccggcgccacagggcgtggccggc
gagctgtacctgggcggcatgggcctggcgcgcggctatctgaaccgccccgcactgacg
gccgagcgctttgtggccgacccgctggacacgcagggcggcctgctgtaccgcacgggc
gacctggtgcgctggaacggcgacggccagatcgagtacctggggcgcctggaccaccag
gtgaagatccgcggcctgcgcatcgagctgggcgagatcgaggcccatctgctggcccag
cccggcgtgcgcgaggccgtggtggtcgcggcacaagccacatcgggcgcggcgggcgca
cgccttgtcgcctatgtggccggcccggacgccgatgcggggctggccgaaaccttgcgc
caggcgctggccgggcggctgccggactatatgcagccttcggccatcgtcgtgctgcct
gcgcttgcgctcaatgccaacggcaaggtggaccgcaaggccctgccgcagcccgaatgg
gcgcagcgtggatacgagccgccgcacaacggggtggagcagcagctgtcggcgatatgg
gccgagcttctggggcaggaccgcgtggggcggcgcgacaacttcttcgagctgggcggg
cactcgctgctggccatgggcatgctggaacgcatgcgtgcgcatggcctgtcggcctcc
gtgcgcagcctgttccagcatccgcaactggcggattttgcggcgcagctgatgcaggcg
gatggcgccgcccaggtgcaggtgccgcccaatggcattcccgaaggctgcacggccatc
acgcccgccatgctggcgctggtggcgctggacgtgcaggagatcgcacgggtcgaggcc
gccgggcccggtggcgcggccaacatccaggacatctatccgctggcgccattgcaggaa
ggcattctgttccaccacacgctgcaccagcagggcgacgcctatgccacgcccacgctg
ctgggcttcgacacgcgcgagcggctgctgggctttgtgcaacggctcaaccgggtcatc
gcacgccacgacatcctgcgcacggccgtgctgtgggaggggttggccgagcccgtgcag
gtggtctgccggcaggcgcaggtgctgctcgactggctggagcctggtgaaagcgagggc
gaaggcgatgtggccgccgtgctgcagaagcgcctggacccgcgcgtgcagcgcatcgat
gtgcgccgcgcgcccatgatccgcgccgtggcggcgcaggatgcgcgcaacggccgctgg
ctgctgcagctgctgacccatcacctggtgctggaccacacgacgctggaacgcatcgtc
gaggagatcgcgctgatggcgcagggccgcgaggcggagctgccgaggcctttgccgttc
aggcgcttcgtggcccaggcccggctgggcgtgagcaccagcgagcatgaggacttcttc
cgcgccatgctcggcgatgtggatgaacccacggcgccgtttggcctgctggatgtgcag
ggcgacggcagcgcggtggaggaggccaggcttgcgctggatgcaccgctgtcgcgcgag
ctgcgccggcaggcgcagcgccatggggtgagtgcggccagcctgttccacctggcctgg
gcgctggtgctgggcaggaccacgggcaaggacgacgtggtgttcggcaccgtgctcttt
ggccgcatgcagggcggggagggcgcgcacagcgcgctgggcatgttcatcaacacgctg
ccgctgcgcatacggctgggcgggcgcagcgtacaggagtgcctgcacgaaacgcatgcg
gggctgacggggttgatgcaccacgagcacgccacgctgtcgctggcgcagcgctgcagc
gctctggcgggggtgacgccgctgttctcggcactgctcaactaccgctacagcgtggcc
ccgcaagagggcgccgcagcggacgcaggctcgggcgcgtgggagggcatgacggccctg
ggcgggcaggagcgcaccaactacccggtggacatgtccatcgatgacctgggccagggc
ttccgcctggtcgggcaggccagcaagaccgtgggcgcgcagcgcctgtgcgcctacatg
ctggccgccgtggaaggcattgttgcggccctggccgaaacgcctgcgttgccggcctgc
gatatcgagctgctggaccgggacgaatgggcgctgctggcgcaatgggcgcaatcgggg
cagtccggatgcaacccgccgcgccgcgacgcccagcccctggtgcacaggctgttcgag
cagcaggtggacgggcggccccaggccacggccctggtctttggcgacgaatgcatcagc
tatgcgcagctcaaccggcgtgccaaccgccttgcgcaccgcctgatcgccgagggcgtg
ggcgcggaggtgcgcgtgggcattgcggtggaacgctcggtggagatggtggtggccgtg
ctggccgtgctcaagtcgggcgcggcctatgtgcccctggaccccggctatccggccgag
cgcctggcccacatggtcgaggacagcggcatggcctgcctgctcacgcagtcccgcctg
gggctggaggtggccggtcgcgtgaaggcgctggacctggatgccatcggcgcgatgccg
gggcccgaccacaaccccggcgccgccgtgcatggcgaatgcctggcctatgtgatctac
acctcgggctccaccggacggcccaagggcgtgggcatctcccaccgctgcctggccgag
caggcgcagctggccgtcggctttgccgcgctgtcgccgcaggaccgcgtgctgcagttc
gccacgctgaatttcgatggctgcatcgagcagctgttcgcgccgctggtggccggcgcg
gccatggtgctgcgcgggcccgaactctgggacagcgccaccttccacagggaactcatg
gccaggcagatcagcgtggccgatctgaccaccgcctactggctgctgctggttcaggat
ttcgcgcgccagggcctgcgcgggtacgggcggctcaggcaggtgcatgtgggcggcgag
gccatgccgggcgccggcctgaaggcctggcgcgatgccgggctgggccatgtgaggctg
ctcaatgcctatggcccgaccgaggccaccgtcacggcctccctcttcgactgcaccggc
ctggtggaaggcgccggcgcggcgccccaggaccttcccataggccggcccctggcgggc
cggcacatgtgggtggtggacgaccggatgcgccccgtgcccctgggcgtggccggtgag
ctgtgcataggcggccccctgctgtcgcgcggctatctgaaccgggcagggctcagcgcg
gagcgctttgtcgccgaccccttcggccgcgatggcgcaagactctatcgcacgggcgac
ctggtgcgctggaatgcgcagggccagctggagtacctggggcgggtggaccaccaggtc
aagatccgcggcctgcgcatcgagctgggcgaggtgcaggcgcaactgctggcgctggac
gatgtgcgcgaggccgtggtcgtggccggcgagggaccggcgggcacgcggctgctggcc
tatgtgtctgcccgcagcgggcggaccctggacgggcaggagatgcgcgagcgcctggcc
acggtactgcccgactacatggtgccgggcgccatcatggtgctggaccagttgccgcag
aacgccaacggcaagctggaccggcaggccctgcccgcgttcggcatgccagccgccagc
caggcgcccgagggcgaactggaggcgctgctggcccgtatctgggccgaggtgctgggc
ctggagcgggtggggcgcagcgacaacttcttcgcgctgggcggtgattccatcctcagc
ctgcagatcgtctcgcgcctgcgccgcttcggctggaagctgtcgccacggcagctgttc
gaacggcaaagcattgccgagctggcgcgtgtggccgagcccgtgcaggacgaggccgtg
cagcaggacacaccggtccagggaagcgttcccctgctgcccattcaggcggagttcttc
gaaacggacgtgccgcagcgatcccactggaaccaggccctgctgctgcgcagcacgcag
ccgctgcagcctgcgccgctgcgccaggccctggccgatctgctggcccggcacgacagc
ctgcgcctgcgctttcgcctcacggcgcagggcgcctgggagcaggcctacgcaagcccg
tccgaggccgacctgcaggcactgctgtgggtgcgccaggcacgggatgccggcgcgatc
gaggccttgtgcgaacaggcgcagcgcagcctggacatcgtccacgggccgctgctgcgc
gggctgtgcatcgaggtgggcgacggcagctggcgcctgctgctggtggcccaccatctg
gtcgtcgatggggtctcctggcgcatcctgctcgaagacctgcgttcggcctatgccagc
cggctgcagggcctggagcccgccagggtccacaagaccgccagctaccagcgctggtcg
caggcgctgcaggcccatgccgcgcaatgcggcggcgagctggccttctggcaggcgctg
gcccaggtgcctgccgtccttccctgtgcccgccccgggggggccaacaccctggcatgg
cagtccagcgtcgagctgcggctggaccgcgagcgcaccgaggccctgatcagccgcgtg
ccggcggcctacaggacgcagatcaacgacatcctgctggccgccctggggcgcgccctg
tgcgcgtggagcgggcagcagcgcatcctcgtggacctggagggccatggccgcgaggag
ctgtcggccggcgtggacgtctcgcgcaccgtgggctggttcaccagcgtcttcccggtg
gcgctcgatgcaggcacaggcccgggcgacgcgatcaagcgcgtcaagcaaagcctgcgc
gaagtgccgctgcacggcctgggccatggcgtgctcaagtacctgggcacggcgcagcaa
aggcaggccatgcaggccttgccccaggccagcctggtcttcaactacctggggcagttc
gatgcaagctttgacagcgcggcccaatggctgccggctgccgagggcagcggcatgccg
gccgacgcctcggcgccgctgtcgcacgagttcaccatcaatggccgcgtctacgacggc
gagctggtgatgacggccgccttcagcacggcccgccacgacaccgccgatgtgcaggcc
tggatggggcgctaccggcaggagctggaagggctgatcgaccactgcctgagcggcgcg
cagggggtgacgccctcggacttcccgctggcccgggtcacgcaggcgcagctggacggc
ctggacctgcctgcgggcaatctggcggacctctatccgctgtctcccatgcagtcgggc
atgctgttccacagcctgtccgatccctcggggctgtcctatgtcacccagctgcgaatc
gacgcgcatggcctggatgccgcgcgcttccgaaaggcctggcaggcggtgctggaccgc
catgccgtgctgcgcagcggcttcctggccgatgcgtccctgccgctgcaatgggtggcc
cggcaggtcctgctggacatcaccgagcatgactgtcggcacagcgaggatgtggcgggg
gccctggatgccctggccgccgggcagttcgcggccttcgacctcagcaagccgccgctg
atgcggctggccctggtccgcgtgtccgatggcagccaccactgcatctggaccgcccac
cacctgctcacggacggatggagttcatcgagcctgctgggcgaggtgctgcgcgactac
aagggcattgccgtggagcccgtggacaccagctaccgcgactacatcgcatggctgcaa
ggcctggaccacggggccagcgaggcctactggaggcgcctggtgcagccgctgcacgag
cccaccttgctggtggatgcgcttgcccggcctgctgtccggcctggtgccttgcctgca
gcccgtcaggggcaccacgaggccggcgccgcgctggatgccggtgccacgcagcagctg
gtggagtttgcccagcgcgagcgcgtgacggccaacaccctggtgcaggccgcatggtcg
ctggtgctggcgcggtacacgggccaggccacggtggccttcggggccacggtggcaggc
cgcccgcccgagctggccggtgtggaaagaatgcaggggctgttcatcaacaccttgccg
gtggtcgtggcctgcgacggcgcgctggagctgggcccctggctgcgcacgctgcaggct
cagaacctggcctcgcgcgagcatgagcagacgtcgctttcagacatccagcgctgggcg
ggcaagggccagcgcggcctgttcgacagcatcctggtgttcgagaactaccccatggat
gccgtgctgtccgcgcatgacgacccgcatctgcggtttgcggtgacgcatgccatcgac
gtgacctcctatcccatggacctggaggtgcggctgggcgatgtgctgtcgctcaagatg
atctaccagcggagcagcttcggcgatgacgccgtgcaggccctgctgcggcaactggtg
caggtactggcgtccatggcgggcgagggcgtgcactgcctgcgggacatcgccttgctg
cccgagcccggccgcgatgggccggcgggcacaggcacaggcatgggcacggatgcctgc
cgcccgccgttcctgcccgtgcatgcctgcatggcgctgcaggcgcgccgggaccccggc
gcggtggcgctggtcatgggcgagcagaccatcagccatggcgagctgcaggcgcgcagc
aaccatttcgccaaccgcctggtgcaggccggcgtggggcgcggcgccatcgtcggcatc
gccatggagcgttcgctggaaatggtgatctgcctgctgtccgtgctcaaggcgggcgcg
gcctacctgcccctggacccggcgtcgccggccgaacgccagaggttcatgctggcagac
agcggtgcctcccacctgatcgcccacagggcggcgctgcacaagctgggcacgcccgct
gtggcccatctggtggtggccgaggaggtggacttcacccaggcctgcaacgcggcgccg
gcccatgccgtgcacgagcgcgacctggcctatgtgatctacacctcgggctcgaccggg
cagcccaagggcgtggtggtcgagcacgggccgctgtccatgcactgcgcggccacggcc
gggatctacggcatgcgggcgaactcgcgtgagctgcatttcatgtccttctccttcgac
ggcgcgcacgagcgttggctgacggccctgagcatcggcgccggcctggtgctgcgcgag
ccgcagatgtggacggcggagcaggcctgcgaggccctgcgccaccacggcatctccaat
gccgcgttcccgccggcctatctggcgcagatcgcggactgggccgcagaacagtcgcag
gagccgccgccggtggagctgtatgtcttcggtggcgaggccatgcccaaggccgcctac
gacaaggtgcgccagagcctgcgcccgcgcctgctcatcaacggctacggccccaccgag
acggtggtgacgccgctgatctggaaggccgaggccagcgagaccttcgactgcgcctac
gcccccatcggccggcccgtgggcgagcgcacggtgcacatcctggatgccgacctgcac
cgggtgccgcacggcgtcgtgggcgagctgtacatcggcggctatggactggcgcgcggc
tatctgtcgcgccacggcctgacggccgagcgcttcgtcgccgaccccttcgacggcggt
ggcggccgcctgtaccgcacgggggacctggtgcgcgagatgccgggcggcaacatcgag
tacataggccgggccgaccaccaggtcaagatccggggcttccgcatcgagctgggcgag
gtcgagaaggccgtccgggccgtgcccggcgtggtcgatgccgccgtgctggtccaggat
gccggtacaggcaagcagctggtggcctatgtggtgggggggagggcacggccgcgcagt
ccctggtccagcgcatccgccagcagacaggcgagcacctgcccgactacatgctgccgg
cccatacgctggtcctgccctccttgccaagactggtcagcggcaagctcgaccgtggtg
cgctgccgctgccgcaggcagatgccgggcgggttcacgtgccaccgtccacagcgtcgg
ccatggcgctggcccgcatctggcaggaggtgcttggcgtggaacgcgtgggcgagaccg
acaacttcttcgaactgggcggggactccctgctcagcctcaggatgcacgccaaggtgc
gcaagctgggcgatccgcagctggacttcaagctgcgcgacctgctgcagcggcccacca
ttgccggcctgctggagcttcgctcagccggcgccggtggagctgggggcgtcgtggcgc
tcaacgccgtgtgtgaggctgcgccaccgctgttttgcgtgcatgccgggttcggcacgg
tgtttgactaccagccgctggcgcgggccttgcaggaccggcgcaccgtccacgccatac
cctgccgcagcctgggcgatcccggctaccgcgaccgctcgctggagcagatggccgacg
actactgcgcgatggtga

DBGET integrated database retrieval system