KEGG   Dictyoglomus turgidum: Dtur_0262Help
Entry
Dtur_0262         CDS       T00800                                 

Definition
(RefSeq) pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00010  Glycolysis / Gluconeogenesis
dtu00020  Citrate cycle (TCA cycle)
dtu00620  Pyruvate metabolism
dtu00640  Propanoate metabolism
dtu00650  Butanoate metabolism
dtu00680  Methane metabolism
dtu01100  Metabolic pathways
dtu01120  Microbial metabolism in diverse environments
dtu01130  Biosynthesis of antibiotics
dtu01200  Carbon metabolism
Module
dtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0262
   00020 Citrate cycle (TCA cycle)
    Dtur_0262
   00620 Pyruvate metabolism
    Dtur_0262
   00640 Propanoate metabolism
    Dtur_0262
   00650 Butanoate metabolism
    Dtur_0262
  Energy metabolism
   00680 Methane metabolism
    Dtur_0262
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dtur_0262
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dtur_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-GeneID: 7083085
NCBI-ProteinID: YP_002352202
UniProt: B8DYW2
LinkDB All DBs
Position
267681..268868
Genome map
AA seq 395 aa AA seqDB search
MKTQVKRIAIEGNEAAALAFKQVNPDVVAAYPITPSTEVVQKFSEYVANGEVDTEFVPVE
SEHSAMSACIGAAAAGARVMTSTASQGLALMWEMLYIASALRLPIVMTVANRALSAPINI
HGDHSDAMGARDSGWIQIFSENVQEIYDNIFQAVKIAEHPDVRLPVMVGYDGFITSHSEE
MIEVLDDEVVRNFIGKYKPQYTLLDVDNPIAVGPLALTDSYFEFKVAQAYALENSLPIIK
HVGKEYGDITGRYYDVIEKYKTEGAEYIIVAMSSTVGTAREVVDALREKGLPVGLLKIRV
FRPFPTEDIINALKDAKVIGILDRSMVPGSFGGPLYHEITSAFYHYDKRPIAQAYVYGLG
GRDITTQHIEKVFEELMDIGKKGKPNPLTYIGVRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcaagtcaaaagaatcgctattgagggtaatgaggcagcagccttagctttt
aagcaggtaaatcctgatgtggttgctgcctatcctataaccccttccaccgaggtggta
caaaaattctctgaatatgtggcaaacggagaagtagataccgaatttgtgcctgtagaa
agtgagcacagtgccatgagtgcatgtattggtgccgctgctgcaggtgcaagggtaatg
acttctactgcatcccaaggacttgctctcatgtgggagatgctttacattgcatctgct
ttaagacttcccattgtaatgactgtggcaaacagagccctctctgccccaataaatatc
catggagatcatagtgatgctatgggagcaagagattctggttggatacaaattttctct
gagaacgtgcaagaaatatatgacaatatctttcaagcagttaagattgcagaacatccc
gacgtaagactccctgtaatggtagggtatgatggttttattactagccactccgaagag
atgatagaagttcttgacgatgaagtagtaagaaactttataggaaaatataagccccaa
tataccttgcttgatgtggataatcctatagcggtaggtcccctcgctctaacggactct
tactttgagttcaaagtagcccaagcctatgcccttgaaaactctcttcccattataaag
catgtaggaaaagaatatggggatattacaggaagatactatgatgtaatagagaagtat
aaaaccgagggtgcagaatatataatcgtggctatgagctctactgtaggaaccgcaaga
gaagtagtagatgctctaagagaaaagggacttcctgtgggacttttgaagatcagagta
ttcagaccattccccaccgaggatattataaatgctcttaaagatgcaaaagtaatagga
attcttgacagaagtatggttcctggatcctttggtggtcctctttaccatgagataact
tctgccttctaccattatgataaaagaccaattgctcaagcatatgtatatggtcttgga
ggcagagatatcactactcaacacatagagaaagtctttgaagagctcatggatataggt
aagaaaggaaaaccaaatcctctcacctatattggagtaagagaatag

DBGET integrated database retrieval system