KEGG   Dyella thiooxydans: ATSB10_21510Help
Entry
ATSB10_21510      CDS       T04308                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dtx  Dyella thiooxydans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dtx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ATSB10_21510
Enzymes [BR:dtx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ATSB10_21510
Transporters [BR:dtx02000]
 Other Transporters
  Pores ion channels [TC:1]
   ATSB10_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2284687..2285316
Genome map
AA seq 209 aa AA seqDB search
MYTLYYSPGTASMVMHMALIESGAPFELKLVDIERGAQRDPAYLALNPRGVVPTLVIDGQ
PRHESAALLMMLADRHPEAGLAPAPGTAAHDAFEQWLVYLSNTLMSTFRFWFYPPELGSA
EHPPQVRAALAAKIEGVWDYLDRALAAQGPYLLGDIFSAADLLLAMLMRWSRNMPRPASQ
WPALARLADLIRARPSWQQVYAVEGLSGW
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaccctctactactcccccggcaccgccagcatggtgatgcacatggccctgatc
gagagcggtgcgccgttcgagctgaagctcgtggacatcgagcgcggcgcgcagcgcgac
ccggcgtatctcgcactgaacccgcgtggcgtggtgccgaccctggtgatcgacggccag
ccccggcacgagtccgccgcactgctgatgatgctggccgaccgtcatccggaagccgga
ctcgccccggcgcccggcacggccgcccacgatgccttcgagcagtggctggtctatctg
agcaacaccctgatgtcgacgttccgcttctggttctacccgccggagctgggctcggcc
gagcatccgccgcaggtccgagcagcgctggcggcgaagatcgagggcgtgtgggattac
ctcgaccgcgcgctggccgcgcaaggcccctatctgcttggagacatcttcagcgccgca
gacctgctgctggcgatgctgatgcgctggtcgcgcaacatgccgcgcccggccagccag
tggcctgcactggcccgtctggccgacctgatccgtgcccgcccgagctggcagcaggtg
tatgccgtcgagggcctgagcgggtggtga

DBGET integrated database retrieval system