KEGG   Dyella thiooxydans: ATSB10_29630Help
Entry
ATSB10_29630      CDS       T04308                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dtx  Dyella thiooxydans
Pathway
dtx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dtx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ATSB10_29630
Enzymes [BR:dtx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ATSB10_29630
Transporters [BR:dtx02000]
 Other Transporters
  Pores ion channels [TC:1]
   ATSB10_29630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AND70417
UniProt: A0A160N3S7
LinkDB All DBs
Position
3176958..3177584
Genome map
AA seq 208 aa AA seqDB search
MTTPRVSFFYAPHTRAGGTLALFEELGVDYDLHLLSLKAGTQRAPAYLAINPMGKVPAIV
HDGALVAEQPAVFIYLADLYPEKGLAPAIGDPLRGPYLRWLVFYGSCFEPAIVDRAMKRE
PAPPSTSPYGSWEQVYDTLVAQLATGPWLFGERFTAADVLWGTALNWTTTFQLVPEHPVI
RGYIDRVLARPAMQRALAKDAGYAAQQG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccccgcgtcagcttcttctacgccccgcacacccgcgccggcggcacgctc
gccctgttcgaggagctgggcgtggactacgacctgcacctgctgagcctgaaggccggc
acccagcgcgcgccggcgtacctggcgatcaacccgatgggcaaggtgccggcgatcgtc
cacgacggtgcgctggtcgccgagcagcccgcggtgttcatctacctggccgatctctat
ccggagaaagggctggcgccggcgatcggcgacccgctgcgtggcccctatctgcgctgg
ctggtgttctacggctcgtgcttcgagccggcgatcgtcgatcgcgcgatgaagcgcgaa
ccggcgccaccgtcgacctcgccgtacggcagctgggagcaggtctacgacaccctggtc
gcccagctggcgaccggtccctggctgttcggcgagcgtttcactgcggccgacgtgctg
tggggcaccgcgctgaactggaccacgacgttccagctggtgccggagcatccggtgatc
cgcggctacatcgaccgcgtgctggcccgcccggcgatgcagcgggcgctggcgaaggac
gccggctacgccgcgcagcagggttga

DBGET integrated database retrieval system