KEGG   Dermabacter vaginalis: DAD186_19940Help
Entry
DAD186_19940      CDS       T04434                                 

Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
dva  Dermabacter vaginalis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dva00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DAD186_19940
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DAD186_19940
Enzymes [BR:dva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     DAD186_19940
Bacterial toxins [BR:dva02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   DAD186_19940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2218525..2220792
Genome map
AA seq 755 aa AA seqDB search
MMNSPFSPYAKVLAFGATVALTLGAPLSALAAPSDTPESAGASAAESSFTSQRIAMGGEG
GFGNYRIPAVMQLRNGDVLLAYDGRPTGTDAPGPNSILMRRSTDGGKTFGPQTVIAAGEK
STPIHGYSDPSFVYDEETGDLFAFFVHSKDTGFWNSQEGHDDADRKVMSAALAVSKDNGK
TWDLRSLTATVKPEGVRATFATSGHGIQLKNGAHKGRLVQQYAGAFTDGTVRAYSVYSDD
HGATWNMGTPVGTKMDENKVVELADGTLMMNSRAHDTHTARWVAYSKDGGETWSEPTLDH
TLTDPRNNASIIRMNPAAAPETREAQELLFSNANSSEGRKNGSIRYSCDSGKTWPTITTF
NAGPTSYSDLVALQDGTFGVFYESADSEQRYGSFTRDFVNPFCAAFGEATADIDAGSTSE
VTFTLRNDDTRDLISGTAVVDLPKGWNAPAVTTPTLKPGESTTITLTVSAPAWASKGEVH
GEVRIDAGDTTVRGDLDLTIVNAAPNTLGATIVGRPGDPDRDLSENPYKVGDEVPYTFRV
DSTANVTETVTPVSGNLSPLVPEGPGNCRWRHLKAGDGYTCASPRYTVTEEDLARGYFIP
ESQWELTGTGLDPVTITVTGEKVWLVAPIENPVVPPAEEPDSTPVEPPTDEAGEEPSNSS
DGDQSEPGKSNNPHASEHPSKDPVINGTQPAGSQQASHANIGRPQSVVQRSGQSAMSSRS
LPRTGTSALLTAAAAAGVLTAGIAMTLGVRQRRQR
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcccccttttccccgtacgcaaaggtgctcgcctttggcgccactgtagcg
ctcacgctcggcgctccgctttccgcactcgcggcaccttctgacacaccggaatcggcc
ggggcctctgctgccgagtcgagctttacctcgcagcgcatcgctatgggtggcgaaggc
ggctttggcaattaccgcatcccggcggtcatgcagctacgcaacggcgacgttcttctc
gcctacgacggccgccccacgggcaccgatgctcccggcccaaactcgatcctcatgcgg
cgttcgaccgacggtgggaaaacctttggcccacagacggtgatcgccgctggtgaaaag
tccacacccattcatggctactcggatccgagcttcgtgtatgacgaggaaacgggtgat
cttttcgcgttcttcgtgcattccaaagacacgggcttttggaatagtcaggaagggcat
gatgacgctgaccgcaaggtcatgagcgccgcactcgcagtgtcgaaagacaacggcaag
acgtgggatcttcgttccctcaccgcgacggtcaagcctgagggcgtgcgcgcgacgttt
gcgacgagtggccacggtattcagctcaagaacggtgcccataaaggtcgtctcgtgcag
caatacgcgggagccttcaccgatggaaccgttcgcgcctattcggtctactccgatgac
cacggcgcaacgtggaatatgggcacgccggtaggcacaaaaatggacgagaacaaggtc
gttgagctcgctgatggcacgctcatgatgaactcgcgtgcccacgacacgcacacggct
cgctgggtggcctattcgaaggatggcggcgagacgtggagtgagcctacgctcgaccat
acgctcaccgacccccgtaacaacgcttcgatcatccgcatgaaccccgcggccgctccc
gagactcgcgaggcacaggaactcctcttctcgaacgccaattcctccgagggccgtaag
aacggcagcatccgctattcgtgcgactcgggtaaaacctggccgacaatcacgacgttc
aatgctgggccaacgtcgtactcggatctcgtcgcgcttcaggacggcactttcggtgtg
ttttacgagagcgccgatagtgagcagcgctacggctcattcacacgggactttgtgaac
ccgttctgcgcggctttcggcgaggcaacagccgacatcgatgcgggaagcacgagcgaa
gtgacgttcacgctgcgcaacgacgacactcgagatctcatctctggcacggcagtcgtt
gacctcccgaagggctggaacgcacctgccgtgacgaccccgaccctcaaaccgggcgag
agcacaacaatcaccctcacggtttcggcccccgcgtgggcgtccaagggcgaggttcac
ggtgaggtgcgcatcgatgctggcgacaccacggtccgcggcgacctcgacctcaccatc
gtaaatgctgcacccaatacgctgggcgccacgatcgtggggcgaccaggagatcccgat
cgggatcttagcgagaatccatacaaggtaggcgacgaggtgccctataccttccgcgtt
gactcaacggcgaacgtcaccgagaccgtcacaccggtgtccggcaatctctccccgctt
gttccggaaggacccggcaattgccgctggcgtcatctcaaggccggcgacggttacacg
tgcgcgtccccccgctacacggtcacggaagaggatctcgcgcgcggttatttcatcccc
gaaagccagtgggagcttaccggaaccggactcgaccccgtaacgataaccgtcacgggc
gagaaggtttggctcgtagctccgatcgagaatccagtggtaccaccggcggaagaaccg
gacagcaccccggtcgaaccgccaacggatgaggcaggcgaggaaccgtcgaactcttcg
gatggcgaccagagtgagccgggtaagtcaaacaacccccatgccagcgaacatccttcg
aaagacccggtcattaacggcacacagcctgccggttcccagcaggcgtcgcacgcgaat
atcgggaggccacaatcggtagtacagcgttcggggcagagcgcaatgtcctcccgcagc
ctcccccgcacaggaacgtcagcgttgctgacggcggctgccgcggcgggtgtcctcacc
gcgggcatagcgatgacgctcggggtacgacagcgccgacagcgctaa

DBGET integrated database retrieval system