KEGG   Drosophila virilis: Dvir_GJ11304Help
Entry
Dvir_GJ11304      CDS       T01066                                 

Gene name
Dvir_Sod
Definition
(RefSeq) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dvi  Drosophila virilis
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dvir_GJ11304 (Dvir_Sod)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dvir_GJ11304 (Dvir_Sod)
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dvir_GJ11304 (Dvir_Sod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MVVKAVCVINGDAKGTVFFEQEGEGCPVKVTGEVTGLAKGQHGFHVHEFGDNTNGCMSSG
PHFNPYQKEHGAPTDENRHLGDLGNIIANGDGPTPVNICDCKITLLGANSIIGRTVVVHA
DPDDLGKGGHELSKTTGNAGARIGCGVIGIAKI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcaaagctgtatgcgttatcaatggcgatgccaagggcacagttttcttcgaa
caggagggcgagggttgccccgtgaaggttaccggcgaggtaaccggcttggcaaagggt
cagcacggcttccatgtgcatgagttcggcgacaacaccaatggctgcatgtcgtcggga
ccgcacttcaatccctaccagaaggagcatggcgcaccgaccgacgagaatcgccatctg
ggcgatttgggcaacatcatcgccaatggagacggtcccactcccgtgaacatctgcgat
tgcaagatcacattgctcggcgccaatagcattattggacgcaccgttgtggtgcacgcc
gatcccgatgacctgggcaagggcggacacgagctgagcaagacaactggcaacgcggga
gctcgcattggctgcggtgtcatcggcattgccaaaatctaa

DBGET integrated database retrieval system