KEGG   Drosophila virilis: Dvir_GJ17191Help
Entry
Dvir_GJ17191      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dvir_GJ17191
Peptidases [BR:dvi01002]
 Metallo Peptidases
  Family M2
   Dvir_GJ17191
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ17191
CD molecules [BR:dvi04090]
 Proteins
  Dvir_GJ17191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF1365
Motif
Other DBs
NCBI-GeneID: 6635836
NCBI-ProteinID: XP_002059471
FlyBase: FBgn0204368
UniProt: B4MEB8
LinkDB All DBs
Position
Unknown
AA seq 628 aa AA seqDB search
MLWQRLLLLLLVATACGATPSSNHSARYEESTLRILDVATERMRGIWDMRRRIFLQLTSK
GKSPLGGQAPSKQEVETETYKLVYELAANLSVVPVEQLRDPLLRRRVQRLAKLQLQGLRP
ADYEQAKDLLRAMQNFISGSLVCTHDDCSARRPLAMYPQIYNQNMRSKSYDDLKLNWYSW
RSAINDKDTAKSTFIDYVRLLRIAATYNGHVTPSRTWYLYYDTENFQAEMEEVIWEIMPL
YREMHAYLRHSAMLAYPKANFKDDGAISAPVMDQMLSQAWYSHQIFRSPYPKDQLPSVHH
RLEEVLVTPVKINKKATEFFESLGLNHMSDGFYERYSRRMNDDEGGPDCKSQVYYFPPDV
ALRYCPKLDYKKMMQIHGTMAELQYNIYKRELPFGLDTEPCPGFGAALGETAVLASGTPR
HLHRLHILLNDSLTEHQSLNRLFRMGVHTLLAVPQYFINDKFLVDVMDGRIGVQDYNCAY
WRLQDKYAGVQPPIWRSAKDFDLDYKFYRGMQPERSNTRKFITEILGFQFYRAFCLASGQ
YKPGDPSYPLHNCDFYDSKEAGALLREMMQLGATRHWRDIMHIATGERKLSGRGVLEYFA
PLFTWLKERNMQLDIEPGWDADELCRKE
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcagcgactcctgttgctgctgctggtcgccacggcgtgcggggccacgccc
agttcgaatcattccgcccgatatgaggagtcgacgctgcgtatactggatgtggccacg
gagcgtatgcgcggcatttgggatatgcgcaggcgcatctttctgcagctcacctcgaag
ggcaagtcgccgttgggcggtcaggcgcccagcaagcaggaggtggaaacggaaacgtat
aagctggtctatgagctggcagcgaatctgagcgtggtgcccgtagagcagctgagggat
ccgctgctgcgacgtcgcgtccagcgtctggccaagctgcagctgcagggcctgcggccc
gccgactacgaacaggccaaggatctgttgcgcgccatgcagaatttcataagcggctcg
ctggtctgcacccacgacgactgctccgcccgccggcccctggccatgtatccgcagatc
tacaatcagaatatgcgcagcaagagctacgatgatctcaagctcaactggtacagctgg
cgcagcgccatcaacgacaaggatacggccaagtccacattcatcgattacgtccgtctg
ctgcgcatcgcggccacctacaatgggcatgtgacgccctcgcgcacctggtacctctac
tatgacaccgagaactttcaggccgaaatggaggaggttatctgggagataatgccgctg
tatcgggaaatgcatgcctatttgaggcactcggcgatgctggcctatccgaaggccaac
ttcaaggatgatggcgccatctcggcgcccgtaatggaccagatgttgtcgcaggcatgg
tactcgcatcagatctttcgctcaccgtatcccaaggatcagctgccctcggtgcatcat
cgactggaggaggtgctggtcacgcccgtcaagattaacaagaaggcaaccgagttcttc
gagtccctaggcctgaatcacatgtccgacggcttctatgagcgctactcgcggcgcatg
aacgacgacgagggcgggccggactgcaagtcgcaggtgtactactttccgccggatgtg
gcgctgcgctactgccccaagctggactacaagaagatgatgcagattcacggcaccatg
gccgagctgcagtacaacatctacaagcgggagctgcccttcggcctcgacaccgagccg
tgtccgggctttggcgctgccctcggcgaaacagccgtcctggcctcgggcacaccgcgt
cacctgcaccgcctgcacattctgctcaacgacagcctgaccgagcatcagtcgctcaat
cggctgttccgcatgggcgtacatacgctgctggccgtgccgcagtatttcatcaacgac
aagtttctggtggatgtgatggacggacgcattggtgtccaggattacaattgcgcctac
tggcgcctgcaggacaaatacgcgggcgtacagccgcccatttggcgctccgccaaggac
tttgacctggactacaaattctatcgcggcatgcagccggaacgctccaataccagaaag
ttcatcacggagattctgggctttcagttctatcgcgccttctgcctggccagcggccaa
tacaagccaggagatcccagctatccgctgcacaactgcgacttctacgacagcaaggag
gcgggcgccctgctccgcgagatgatgcagctgggcgccaccaggcattggcgcgacatt
atgcacattgccacgggcgaacgtaagctgagtgggcgtggcgtcttggaatactttgcc
ccgctcttcacctggctaaaggagcgcaacatgcagctggatatcgagcccggctgggat
gccgatgagctatgtcgcaaggaatag

DBGET integrated database retrieval system