KEGG   Drosophila virilis: Dvir_GJ24041Help
Entry
Dvir_GJ24041      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dvi  Drosophila virilis
Pathway
dvi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dvir_GJ24041
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dvir_GJ24041
Chromosome and associated proteins [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dvir_GJ24041
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dvir_GJ24041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo GTP_EFTU Dynamin_N
Motif
Other DBs
NCBI-GeneID: 6630274
NCBI-ProteinID: XP_002053703
FlyBase: FBgn0211128
UniProt: B4LZZ5
LinkDB All DBs
Position
Unknown
AA seq 644 aa AA seqDB search
MATAEAQVNVNTNLQKQDLSNLEISNLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIQKLLHSKQHRNAYDRKQRQLLNRRRQRIGSNR
LELSHNHLFAQYTRTTRSYSQSSLSPSHSSGYGSVLGCDEQDAAPPPSIAAHRNPAAAVA
TPPNMLKRRLSSRSGIQNVEPSPALKRAKDNNGQPIMKPKGEYIVERIERVEVLHYEPVF
YVKWLGYDSSKNTWEDFINLADCVQLEEFVERQTLFYAVHIAQISKELETQLAETAPLDM
SSISMKDDVENYEALPLNLDLILLAQYRAAGSRSQREPQRIGERALRRLQLQRCHYARRK
QLQALAQFEKRMNAVELPAPPIRVHNDVDLDIIDSSFVYIQKNILTDGVPRPEASVLGCS
CNEQPGMNECSATSRCCARLAGELYAYERTTRRLRLPQGSAIFECNSRCCCDASCTNRLV
QNGRNHPLELFKTSNGRGWGVRTPHSLRKGEFVCEYVGEIITSDEANERGKAYDDKGRTY
LFDLDYNTAAESEYTIDAANYGNVSHFINHSCDPNLAVFPCWIEHLNMALPHLVFFTLRH
IKAGEELSFDYIRADNEDVPYENLSTAVRVECRCGAANCRKVLF
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagctcaagtcaatgtgaacacaaatttgcaaaagcaggaccttagc
aatttggaaatcagcaacttgacgcccctgtcgcctgaggtgatctcgcgccaagctacc
atcaacattggcacaatcggccatgtagcgcacggcaaatccacggttgtcaaagccatc
tccggcgtgcagactgtccgctttaaaaatgaattggagcgaaacattacaattaagctc
gaacgcttaagcgaaaagaaaatccaaaaacttttgcactccaagcagcaccgtaatgca
tacgatcgcaagcagcgccagctgctcaatcgccggcgacaacgcatcggaagtaaccga
ctggagctgtcccataaccatttatttgcgcaatatacgcgtactacgcgcagctacagc
caaagctcgctgagtcccagtcacagcagcggctatggcagcgttttgggctgtgacgaa
caggatgctgcaccgcccccgtctattgccgcacatcgcaacccagctgcagctgttgcc
acgcccccaaatatgctaaagcgacgacttagttccagaagcggcattcaaaatgtggag
ccatcgcccgctttaaagcgcgcaaaggataacaatggtcagcccattatgaagccaaag
ggcgagtatattgtggagcgcattgaacgtgttgaggtgctgcactacgagcccgttttc
tatgtcaaatggctgggctatgatagcagcaagaacacctgggaggatttcattaatttg
gccgactgtgtgcagctggaggaattcgtggagcgccagacgcttttttacgcggttcac
atagcacaaatcagcaaagaactggagacacagctggccgaaaccgctccactggatatg
agcagtattagcatgaaggacgatgtggagaattatgaagccttgcctctgaatttggat
ctgatattgttagcacagtatcgtgcggcgggcagtcgcagtcaacgcgagccccagcgc
attggcgaacgtgcactgcgacgccttcagctgcagcgctgtcattatgcacgccgtaag
cagttgcaggcgcttgctcagtttgagaagcgcatgaacgccgtcgagctgccggcaccg
cctatacgcgtccataacgatgtcgacctggacatcatcgattcgagtttcgtttatatt
cagaagaacatattgaccgatggtgtgccgcgaccggaggcatctgttttgggctgtagc
tgcaatgagcagccaggcatgaatgaatgcagcgccacgagccgctgttgcgcccgtctc
gccggcgagctgtatgcctacgagcgtaccacgcgacgcctgcgcctgccacagggcagc
gccatcttcgagtgcaatagtcgttgctgttgtgatgccagctgcacaaatcgtctggtt
caaaacggacgcaatcatccgctggagctgttcaagacgagcaatggacggggttggggt
gtacgcacaccgcattccctgcgcaagggggagtttgtgtgcgaatatgtgggcgagatc
atcaccagcgatgaggccaatgagcgtggcaaggcctacgacgataagggacgcacatat
ctctttgatctggactacaatacggctgctgaaagcgaatacaccatcgatgcggccaac
tatggcaatgtctcgcattttatcaatcactcgtgcgatcccaatttagccgttttcccc
tgctggattgagcacctgaacatggcgctgccccatttagtgttctttacactgcgccac
atcaaggccggcgaggagctgagctttgattatatacgcgccgacaacgaggatgtgccc
tatgagaatctatcgacagctgtgcgcgtcgagtgccgctgcggcgccgccaattgccgc
aaagtgctcttctag

DBGET integrated database retrieval system