KEGG   Drosophila virilis: Dvir_GJ24607Help
Entry
Dvir_GJ24607      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform E
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
dvi  Drosophila virilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dvir_GJ24607
Enzymes [BR:dvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dvir_GJ24607
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dvir_GJ24607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 2187 aa AA seqDB search
MATPQVKDLVLRSPAGSSDTITFAWPLQIGHGQDKHDNGIDIIDTIKFVCDELPSISSAF
EEINLNHIDTACYKTMTNLVDRFNKAVDSIVALEKGTSLPAERLNKFAHPSLLRHILQLV
YNAAVLDPDKLNQYEPFSPEVYGETSYELVQQMLKHVNVSKEDTFIDLGSGVGQVVLQMA
GSFPLKTCIGIEKADTPARYAERMDQIFRQYMSWFGKRYCEYKLIKGDFLVDEHREKITS
STLVFVNNFAFGPTVDHQLKERFADLRDGARVVSSKSFCPLNFRITDRNLSDIGTIMHVS
EIPPLKGSVSWTCKPVSYYLHVIDRTILERYFQRLKTKGGDHEHVGTVRTTRDRAKREAN
IGHQNNNHNNNNNHNNNHQREQREQQRERERDLFNGPAQQRNQSQSPANVSGGGGLAASK
TRQQLASAQHQQQQQQQQQQMQQRSLDMDSSTESDGEGEATNGNGGNTTTATTSTSNGPM
TRKVWSDWCSSKGKSSQSDDEENNNSNSNNSNSHQGRGPRAITTLKKRKKLTRKAAIASK
SAAAAQREAEEAAAVAAVTASATSASASKDSSSKEDQPRAASAGPGRKGRLKKGQRGRKC
LKIAGLDVLHKQTVLSTSLDAMTKKLPAAPGTVDQQLTSLLTGDMSHRELDIPTAPQDTP
YALQILLDVFRSQYMTMIEHMRSSAYLPQVQKQIAQEQERMARLKNRANQLDKQIKVLID
DSVTLLKVRMNELGINVNSPNDLIAQAKEIVGRHKDLQHAVSKMRNEVTVYESEQKLLLS
KQLKHLPEYQKLCAVANGGNGKVKLELPHELSETAAQELVLKEIANTLSQRKKLYAQVST
IEQETSSLQKSAEERSTANVLLAQGTNISLASSAPTVATNAATTATLANCNKLVNNKSSR
RSREHRARSQEWPEVPEVGKIQESNPEVLAQKILETCRQVEAGKFQPPPSTISAVNFING
QKPKMEPKTTPAPYKDSTLMPAPKQQSQPQQQQQQLQQQQQQQHHAVLLPKCELPGLGRK
QESPKVANFEDRLKSIITSALNEDQEQRSKAMPIMETPAVPLQSPVSKRSKQMGQTTTTT
GNSLHNIITVSTQGLMHLNANTTISPITPPLPGPRAAAAASTAPPPPANLPYGSAYMSSK
QQQLQHLSGKYGQTVSLKESKYSPARPGASAPPPPPPPPPTSSSASSSSSSSSAAHMATL
YAGHGSTAATAPTVADLGFHRRRASVSANSYEHFMVQQQQQQQHALMLAHVAQQRLQHQQ
QQQQQQQQQQQQQQQHAQHAPIGHLHHHHHQAAGTSAEFKAPAENLLQRSGSREQLSEQQ
QQQQQQQQQLQQQHQHQHQQSQQQQPHSLDLLPRASSANSDYAGYRVERLSVRPPSRPSS
NSSQPDYTQVSPAKMALRRHLSQEKLSQPPQALPTPPPMSLAPPVTAGKTIGDLVNGEIE
RTLEISHQSIINAAVNMSTGSSSSSSSAHFMERAFLAERTNDRLLINLNAQRPERVHVRP
LGEDAPDPQPTNYSQAASSSNNNLATLAHVAYAHKTQPGARASSSSRSGRDYQPVALPRA
EMMGCIEAYFHEEQQQQQQQQQQHQKSKSTVGGASALRAPRLNGANPPLEGLAASLQDHV
RARKYKEENEERQRRAAAASSSSSLELAPHFAHQAPPAHSYHQPQQQPHHHTAASIINGT
PHKVELGVKRSSPLAPHQQPSRPAKLAHFEQQPLAHAHQHLYVNSNGVSGLPPPAHDATT
PSPTPSSSSSSCGRRSKLLVEPPLLMSPEINSLMGDERPLQLSTSHQQLHHHQQKPHQQQ
LRGSHQSGHSITPTIVGGQRSNAADDDDVIAADEESHWQHRVSSGFDRLVAFASTELDKT
RRSIDGDTVPASISCNTSPDSGITHSSSNSDAVRTFLSTSSSSSQLELPINNSSSSSSSN
NSSSLYASQVHNLSHHTYQHGHQQLQQQQQQLPLQQQQQQQQAQQQHPQQQQQQHLADHL
SDSSMKSTASSSLHASSSLKTVSPVDSGAIESPPLSDVGLPRTPSPSAASVATPPLAHAP
SLVNELRIPLKYQRKSKSGSEKHYKKKFCERNWEYDCDELLAYSNSSAPPTAADAAGNGP
PALDVTGGVSATPPVGLSKSGKSPKEKSSPHHGINTNANANASFHHHHKSSKFRPKGKDW
DWSLDSRSNTGEPTANGAGGGANTTSN
NT seq 6564 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccgcaagtcaaagacttggtgttgcgctcgccagctggctcctccgatacc
atcacatttgcctggccactgcagattggacatggacaggataagcatgacaatggcatc
gatatcatcgacacaattaaattcgtctgcgatgagctgccatcaatttcatccgcattc
gaggagattaacctcaatcacattgacactgcctgctataagactatgacaaatcttgtc
gatcgcttcaacaaggctgtcgacagtattgttgcattggaaaaaggaacttcactgccc
gccgagcgcttgaataagttcgctcaccctagccttttaagacacatactgcaattagtt
tacaatgctgccgtactcgatccggacaaactcaatcagtacgagcccttctcgccggag
gtgtacggggagacgtcgtacgagctggtacagcaaatgctcaaacatgtcaacgtcagc
aaggaggacacgttcattgatctcggttccggtgtgggacaggtggtactacaaatggcc
ggctcgtttcccctcaagacatgcattggcatcgagaaggcggacacgcccgctcgctat
gcggaacgcatggatcagatctttcgacagtacatgagctggttcggcaaacgctactgc
gagtacaagctgatcaagggtgactttctggtggacgagcatcgcgaaaagatcacctcc
tcgacgctggtgtttgtcaataactttgcctttggtccgaccgtcgatcatcagctgaag
gagcgatttgccgatttgcgagatggcgctcgagttgtgtcatccaaatcgttctgtccg
ctcaactttcgtattacagatcgaaacctcagcgacattggcacgattatgcatgtgagc
gaaataccgcccctgaagggctccgtttcatggacctgcaaaccggtttcatattatttg
catgtgatcgatcgcaccattttggagcgctattttcagcgcctgaaaaccaagggcggt
gatcatgagcatgtgggtaccgtgcgcaccacacgtgatcgcgccaaacgtgaggccaac
attggccatcaaaacaacaatcacaataacaacaacaatcacaacaacaaccatcagcgg
gagcagcgggaacagcaacgtgagcgggaaagggatctgttcaacggccccgcccagcag
cgcaatcaatcgcagtcgccggcaaatgtcagcggtggcggtggattagccgcctccaag
acgcgccaacagcttgcaagtgcgcagcaccagcagcagcagcagcaacaacaacaacag
atgcagcaacgcagtctggacatggacagcagtacggagagcgacggtgagggcgaggcg
accaatggcaatggcggcaacaccaccacggccaccacgtccacgtcgaatgggccaatg
acgcgcaaggtgtggtcggactggtgcagctccaagggcaagagttcacagtcggatgac
gaggagaacaacaatagcaatagcaacaacagcaacagccaccagggtcgcggcccacgc
gccatcaccacgctgaagaagcggaagaagctaacgcgcaaagcggctattgccagcaaa
tcggcggcggccgcacagcgcgaagcggaagaggcagctgctgttgctgcagttactgca
tccgcgacgtctgcctcggccagcaaggattccagcagcaaggaggatcagccgcgtgct
gcgagcgctggacccggacgcaagggccgcttaaagaagggacaacgtggacgcaaatgc
ttaaagattgccggcctcgatgtgctgcacaagcagacggtgctgagcacctcgctggat
gcgatgacaaagaagctgcccgcagcgccgggcacagttgaccaacagctgacgtcgctg
ctcaccggcgacatgtcgcatcgcgaactggacatacccacagcgccccaggatacgccc
tacgccctgcaaatactgctcgatgtgttccgctcccagtatatgaccatgattgagcat
atgcgctcgagcgcgtatctgccgcaggtgcagaagcaaattgcccaggagcaggagcgt
atggcgcgccttaaaaaccgggccaatcagctggacaagcagatcaaggtgctgatcgat
gatagcgtaaccctgctgaaggtgcgcatgaatgagctgggcatcaatgtgaactcaccc
aacgatctgattgcccaggccaaggagattgtcggacggcacaaggatctgcagcatgcg
gtcagcaagatgcgcaacgaggtaaccgtctacgaaagcgaacagaaactgctgctgagc
aagcagctgaagcatctgcccgaataccaaaagctctgtgccgtcgccaacggcggcaat
ggcaaggtgaagctcgagctgccgcacgagctgtccgaaactgcggcccaggagctggtg
ctcaaggagatagccaatacgctgagccagcgcaagaagctctatgcgcaggtctctacc
atcgaacaggaaaccagctcgctgcaaaagtccgccgaggagcgcagcacagccaatgtg
ctgcttgcccagggcaccaacatcagcctggctagtagcgccccaacagtggcaacgaat
gcagcaacgacggcgacgctggccaattgtaacaaattggtaaataacaaatcgtcgcgt
cgcagtcgcgagcatcgagcacgctcgcaggaatggcccgaggtgccggaggtgggcaag
atacaggagagcaatcccgaggtgctggcccagaagatactcgagacctgtcgccaggtc
gaggcgggcaaattccagccgcctccaagcaccatcagcgccgtcaactttatcaatggc
caaaagcccaaaatggagcccaagacgacgccggcgccctacaaggacagcactctgatg
ccggcgcccaagcaacaatcgcagccacaacaacaacaacagcaactgcaacaacaacaa
caacaacaacatcatgctgtgctgttgcccaagtgcgagctgccgggactgggtcgcaag
caggaatcacccaaggtggccaactttgaggataggctgaagagcatcataacatcagcc
ctaaatgaggatcaggagcagcgcagcaaggcaatgcccattatggagacgccggctgtg
ccgctgcaatcgcccgtctcgaaacgcagcaagcaaatgggccaaacaacaacaacaacc
ggcaacagcttgcacaacattatcaccgtttcaacgcagggcctgatgcatttgaatgcc
aatacgaccatatcgcctataacgccacctttgccgggtccgcgtgctgcagcagctgcg
tcgacggcgccgccgccgcccgccaatttgccctacggcagcgcctacatgagcagcaaa
cagcagcagctgcagcatttgtcgggcaaatatggccaaacggtgtcgctcaaggagtcc
aagtattcgccagcccgaccaggtgcatcagcaccgccgccgccaccaccaccaccgccg
acctcctcgtccgcgtcgtcgtcgtcgtcgtcgtcgtcagcagcgcatatggccacgctc
tatgctggacacggctcaacagcggcgacagcgcccacagtcgctgatctgggctttcat
cggcggcgtgcctcggttagcgccaacagctacgagcattttatggtgcaacaacagcag
cagcagcaacatgcgctcatgttggcccatgtggcacaacagcggctgcagcatcagcag
cagcagcaacagcagcagcagcagcagcagcaacaacaacaacaacatgcacaacacgcg
ccaattggacaccttcatcatcatcatcatcaggcagcgggcacatcagctgagtttaag
gcgccagcagagaatctgctgcaacgctccggcagtcgcgaacaactttcagagcaacag
cagcagcagcagcagcaacaacaacaattgcaacagcaacaccaacaccaacaccaacag
tcacaacaacaacagccacacagcctggatctactgccgcgtgccagttcggccaactcg
gactatgctggttatcgcgtggaacgtctgtctgttcgaccgcccagtcggcccagctcc
aactcctcgcagccagattacacgcaggtgtcgccagcaaaaatggcgctgcgtcgtcat
ctctcgcaggagaagctcagtcagccgccgcaggcgttgcccacgccaccgcccatgtcg
ctggcgccgccggtgacagccggcaagaccatcggtgatctggtcaatggcgagatcgag
cgcacgctggaaatctcacatcagagcatcatcaacgcggcggtcaacatgagcaccggc
agctccagcagcagcagcagtgctcatttcatggaacgcgccttcctggccgagcgcacc
aacgaccgtctgctcattaatctgaatgctcaacggccggagcgtgtgcacgtacgaccc
ttgggcgaggatgcgccggatccgcagccgacgaactacagccaggcggcatccagcagc
aacaacaatctggccaccttggcccacgttgcctacgcccacaaaacgcagccgggcgca
cgtgcctcctcgtcctctcgttctggacgtgactaccagccggtggcattgccgcgcgcg
gaaatgatgggctgcatcgaggcctacttccacgaggagcagcagcagcagcagcaacaa
caacagcaacatcagaagtcaaagagcacagtcggtggtgccagcgcgctgcgtgcacca
cgattgaatggcgccaatccgccattagaaggactagccgcctcgctgcaggatcatgtg
cgagcacgcaaatacaaggaggagaacgaggagcgacaacgacgcgctgcagccgcttca
tcatcatcatcattggaactggcgccgcatttcgctcatcaggcgccgcccgcccacagc
taccatcagccgcaacagcagccgcatcatcatacagccgccagcattatcaatggcacg
ccgcacaaagtggagctgggcgtgaagcgtagctcgccgctggcgccgcaccagcagccg
tcgcgacccgccaaattggcgcatttcgaacagcagccgcttgcccatgcgcatcagcat
ctgtacgtgaatagcaatggggtgtcgggtctgccgccgccagcacatgatgccactacg
ccgtcgccgacgccgtcatcctcatcctcgtcatgtggcaggcgcagcaaattgcttgtg
gagccgccgctgctgatgagtcccgagatcaactcgctgatgggcgatgagcggccgctg
cagctgtcgacgagtcatcagcagctgcaccaccatcagcaaaagccacatcagcagcag
ctgcgcggctcgcatcaaagtggtcacagcatcacgcccaccattgtgggcgggcagcgc
tccaatgcggccgatgacgacgatgttattgcggccgacgaagagtcccactggcagcat
cgggtcagctccggctttgatcggctggtggcctttgccagcactgagctggacaagaca
aggcgctccattgatggcgacacggtgcccgcctccataagctgcaacacctcgccggac
tcgggcatcacgcacagcagcagcaactcggatgcggtgcgtacatttttgtccacctcg
tccagttcgtcgcaactggagctgccgattaacaacagcagcagcagtagcagcagtaat
aacagcagcagcctctatgccagccaggtgcacaatctgagccatcatacgtatcagcat
ggccatcagcaattgcagcagcagcagcagcagctgccattgcaacaacagcagcagcag
cagcaggcacagcaacaacatcctcagcaacagcaacagcagcacttggcagatcatttg
agcgacagcagcatgaagtctacggcctcctcatcgctgcacgcgagcagctcgctgaag
accgtttcgccggtagactcgggcgccattgagtcgccgccgctgtccgatgtgggtctg
ccacgcacgccaagtcccagtgccgccagcgtggccactcccccgctggcccatgcgccg
tcgcttgtcaacgagctgcgcataccgctcaaatatcagcgcaagtcgaagagcggctcc
gagaagcactacaagaagaagttctgtgaacgcaactgggagtacgactgcgacgagctg
ttggcctactccaactccagtgcaccgccgacagcagccgatgcagcgggcaatgggccg
cccgcattggatgtaaccggcggcgtgtcagcaacaccgccagtggggctgagcaaatcg
ggcaaatcgcccaaggagaaatcgtcgccacatcatggcatcaataccaatgcgaatgcg
aacgccagctttcaccatcatcacaagtcgtccaagtttcggcccaagggcaaagactgg
gactggtcgctggatagcagaagcaacacgggcgagccgacggcaaatggagccggcggt
ggcgcgaatacaacgagtaattaa

DBGET integrated database retrieval system