KEGG   Desulfovibrio vulgaris Hildenborough: DVU2920Help
Entry
DVU2920           CDS       T00171                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Brite
Translation factors [BR:dvu03012]
 Eukaryotic Type
  Elongation factors
   DVU2920 (tuf)
 Prokaryotic Type
   DVU2920 (tuf)
Mitochondrial biogenesis [BR:dvu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DVU2920 (tuf)
Exosome [BR:dvu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DVU2920 (tuf)
  Exosomal proteins of breast cancer cells
   DVU2920 (tuf)
  Exosomal proteins of colorectal cancer cells
   DVU2920 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3019503..3020696
Genome map
AA seq 397 aa AA seqDB search
MGKEKFERKKPHVNIGTIGHIDHGKTTLTAAITKTAGLLGQGKFIAYDEIDKAPEEKERG
ITIATAHVEYETATRHYAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVELEVRELLTSYGFPGDDVPVVRGSALKALE
SDDPNSDACKPIRELLAACDSYIPEPQRDIDKPFLMPIEDVFSISGRGTVVTGRVERGVI
KVGEEVEIVGIKDTTKSTCTGVEMFRKLLDQGQAGDNIGALLRGVKRDDVERGQVLAAPK
SITPHRKFKAEVYVLSKEEGGRHTPFFSGYRPQFYFRTTDITGVITLEEGVEMVMPGDNA
TFNVELIAPIAMELGLRFAIREGGRTVGAGVVSEIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggaaaaatttgaacgcaagaagccgcacgtcaatatcggcaccatcggtcac
atcgaccatggtaagaccactctgacggcagccatcaccaagaccgcaggcctcctcggt
cagggcaagttcatcgcgtacgacgaaatcgacaaggctcctgaagaaaaggaacgtggc
atcaccattgccaccgcccacgtcgagtacgagaccgctacgcgtcactacgcgcacgtc
gactgccccggtcacgccgactacatcaagaacatgatcaccggtgcggcccagatggac
ggtgccatcatcgtcgtcgccgccaccgacggtcccatgccccagacccgtgagcacatc
ctgctcgcccgtcaggtcggcgtgccctacatcgtcgtgttcctgaacaagtgcgacatg
gtcgatgacgaagagcttctcgaactcgttgaactcgaagttcgcgaacttctcaccagc
tacggcttccccggcgacgacgttccggtcgtgcgcggctccgccctcaaggctctcgag
tccgacgatcccaactctgacgcctgcaagcccatccgcgagctgctcgccgcttgcgac
agctacatccccgagcctcagcgcgacatcgacaagcccttcctgatgcccatcgaagac
gtgttctcgatctccggccgcggtaccgttgttaccggtcgtgtcgagcgcggtgtcatc
aaggtcggtgaagaagtcgaaatcgtcggcatcaaggacaccaccaagtcgacctgcacc
ggcgtcgaaatgttccgcaagctgctcgatcagggtcaggctggcgacaacatcggtgcc
ctgctccgtggcgtgaagcgtgacgacgtggaacgcggccaggttcttgccgctcccaag
tccatcactccccaccgcaagttcaaggctgaagtgtacgtcctttccaaggaagaaggc
ggtcgtcacactccgttcttctcgggttaccgtccccagttctacttccgtaccacggac
atcactggtgtgatcacccttgaagaaggcgtcgagatggtgatgcccggcgataacgcc
accttcaacgtggaactcatcgcccccatcgccatggaactcggtctccgcttcgctatc
cgcgaaggtggccgtaccgtcggcgcaggcgtggtttccgagatcgtggagtaa

DBGET integrated database retrieval system