KEGG   Drosophila willistoni: Dwil_GK25046Help
Entry
Dwil_GK25046      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dwi  Drosophila willistoni
Pathway
dwi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dwil_GK25046
Enzymes [BR:dwi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dwil_GK25046
Chromosome and associated proteins [BR:dwi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dwil_GK25046
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dwil_GK25046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo Pex14_N Phage_TAC_10
Motif
Other DBs
NCBI-GeneID: 6649359
NCBI-ProteinID: XP_002071618
FlyBase: FBgn0227005
UniProt: B4NCP5
LinkDB All DBs
Position
Unknown
AA seq 589 aa AA seqDB search
MTAKASQGKSTLSSLEKAPINNITVELKRLRNRNIEIYLPSIQPNDIYEVKKPRISAKTR
KGSAQQPTKLDDSESTRNSRGNSTSSSSGYGSLSDDQQLPESQGRPQHDTLPSSVGNDNQ
QLGKSLRRRRYTQYQEVVASSTRDKPLPRRHTQYTERAPVMMASQQRTPIGEYTVECIEA
VEVIHCQPLFCVKWLGYTEDNNTWETYDNLANCAALDKFVATKYKFLKKYIVPISKELEA
RLKNVPKNENFTMMQIEGYDPLKLRLDLIILAQFRASGSSSFVRRFRITERALLWMQLRD
MNLQRRRQLKALAQFEKIISNADRASPGIKVENNVDLERIDANFVYSSKNIWGSRVPEPR
MRLLACKCSNIRHGNTCCPSSRCCARLANELFAYNKVTKRLRLTPGSAIFECNSLCSCDS
TCPNRVVQHGRQLELVLFKTSNGCGWGVRTDHALAKGEFICEYIGEIITSKEADKRAKLY
ENCGRRRIYLFALDYNVAQDDEYTIDATNFGNISRYLNHSCDPNIAVFPCWIEHSHFALP
RLVFFTLRSIKAGEELCFDYMRGTKVQDIPQSKRIACRCGAKDCRKVVF
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaaagccagccaaggaaaatccacgttgtcatcgttggaaaaggcacccata
aacaatataacggttgagctaaaacgactaagaaatcggaatatcgaaatatatctgccc
tccatacaaccgaatgatatatatgaagtcaaaaagccaaggattagtgcgaaaacccgg
aaggggagcgctcaacagccaacgaagctcgacgattcggagtcaacacgcaattccagg
ggcaattcgacaagcagtagcagtggctatggcagcctttcggatgatcagcagctacca
gaatctcaggggcgtccgcagcacgacacgctcccatcatcggtggggaacgacaatcaa
caattgggcaaatctctgaggcgtcgccgctatactcagtaccaggaagtggtggcatca
tctacaagggacaaaccactgccgcgtcgccatactcagtacacggaaagggctccagtg
atgatggccagccagcagcggacacccattggcgaatacacagtggagtgcattgaagca
gtggaggtcattcactgccagcccttgttttgcgtcaaatggttgggctataccgaagac
aacaatacgtgggaaacttacgataatctggccaactgtgcggctctagataaatttgtg
gcaaccaaatataaatttttaaaaaaatatatagtccccatatcgaaggaactggaggca
cggttgaaaaatgtacccaagaatgagaatttcaccatgatgcagattgagggctatgat
ccattaaaacttaggctggatcttatcatactggcccaatttcgggcatccggtagttcg
agcttcgtgagacgttttcgtattaccgaaagagctctactttggatgcaattgagggac
atgaatctgcagagacgccgtcaattgaaggcattggcacagtttgagaagattattagt
aatgcggatagggcatcgcctggcattaaagtggagaacaatgtggatcttgaacgaatc
gatgcaaatttcgtttacagcagcaagaatatttggggctcgagggtgcccgagccgaga
atgcgcctgctggcatgcaaatgttcgaatatcagacatggaaacacatgttgcccatcg
agtcgctgttgtgctcgtttggccaatgaactgtttgcctataacaaggtaacgaaacgt
ttgcgcctcacacctggcagtgccatctttgagtgcaacagtttgtgctcctgcgactcg
acgtgccccaatcgtgtcgtccagcatggacggcagctggagttggttctcttcaagacc
agtaatggctgcggctggggtgtgcgcactgaccatgccttggcaaagggggaattcatt
tgcgagtacattggtgagattataaccagcaaagaggccgataagcgggccaagttatat
gagaattgtggtcgccgtcgtatttacctgtttgctctcgactacaatgtggcccaggat
gacgagtataccatcgatgccaccaactttggcaatatctcccgttatctcaatcattca
tgtgatcccaatatagctgtatttccatgctggattgagcattcacattttgccctgccc
cgtttagttttctttaccctgcgctccataaaagctggcgaggaattgtgttttgattac
atgcgagggactaaagtgcaggatataccccagtccaagcgtattgcgtgtcgttgtggt
gccaaagattgtcgaaaagttgtattttga

DBGET integrated database retrieval system