KEGG   Drosophila yakuba: Dyak_GE23669Help
Entry
Dyak_GE23669      CDS       T01068                                 

Gene name
Dyak_Hex-t2
Definition
(RefSeq) Hex-t2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE23669 (Dyak_Hex-t2)
   00051 Fructose and mannose metabolism
    Dyak_GE23669 (Dyak_Hex-t2)
   00052 Galactose metabolism
    Dyak_GE23669 (Dyak_Hex-t2)
   00500 Starch and sucrose metabolism
    Dyak_GE23669 (Dyak_Hex-t2)
   00520 Amino sugar and nucleotide sugar metabolism
    Dyak_GE23669 (Dyak_Hex-t2)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dyak_GE23669 (Dyak_Hex-t2)
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dyak_GE23669 (Dyak_Hex-t2)
Membrane trafficking [BR:dya04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dyak_GE23669 (Dyak_Hex-t2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
3R
AA seq 478 aa AA seqDB search
MKRTSRLFTHSLFGPVLKILFREGKMPSLVNTEIEAAVKGFLIDQEKMTEVVERMTKEIK
MGLAKDTHSRAVIKCFVSHVQDLPTGKERGKYLALDLGGSTFRVLLVNLLSESDVEIVSK
SFNFPVTLMSGSGKALFDFLAECLSEFCHYHGLENESLPLGFTFSFPVQQQGLSKGILVA
WTKGFSCEGVVGKNVVTLLQEAIDRRGDMKVNTVAILNDTVGTLMSCAYYHPNCRIGLIV
GTGSNACYVEKTVNAECFEGYQTSPKPSMIINCEWGAFGDNGVLEFVRTTYDKIVDKVTP
NPGKQTFEKCISGMYMGELVRLVVMDMVARDLMFHGTTSERMQERWSFKSSYISDIESDA
PGEYRSCNKVLSELGIVGCQEPDKEALRFICEAVSSRSAKLCACGLVTIINKMNINEVVI
GIDGSVYRFHPKYHDMLQFHMKKLLKPGVKFELVVSEDGSGRGAALVAATAVQGKAKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggacgtctagacttttcactcattctctatttggccccgtactgaaaattttg
tttcgtgaaggaaaaatgccgagcctggtgaacacggaaattgaggccgcggtcaagggc
ttcctcatcgaccaggagaagatgaccgaggtggtggagcgcatgaccaaggagatcaag
atgggcctggccaaggacacgcattcgcgggcggtgatcaagtgcttcgtcagccatgtg
caggatcttcccactggcaaggagcgtggcaagtatttggcactcgatctgggtggctcc
actttcagggtgctgctcgtgaacctgctaagcgaatcggacgtggagattgtctcgaag
agtttcaattttcccgtaacactgatgtccggatctggaaaggcgctattcgacttcctg
gccgaatgcctgtcggagttttgccactaccatggcctggagaacgagtcactgccgctg
ggcttcaccttctcgtttccggtccagcagcagggactctccaagggcatcctagtggcc
tggaccaaaggattcagctgcgaaggcgtggtgggcaagaatgtggtaactctgctccag
gaggccatcgatcgcaggggcgacatgaaggtgaacacagtggccattctcaacgatacg
gtgggcaccctgatgtcctgcgcctactaccatcccaactgccgcataggactgatcgtg
ggcaccggcagcaatgcgtgctatgtggagaagaccgtgaatgccgaatgcttcgaggga
tatcagaccagtcccaagccttcgatgatcattaactgcgagtggggcgcgttcggggac
aatggtgtcctggagttcgttcgcaccacctacgacaagatcgtcgacaaggtgacaccc
aatcccggcaagcagacgttcgaaaagtgcatctcgggcatgtatatgggtgagctggtg
cgcttggtcgtcatggacatggtagccagggaccttatgttccacggcaccacttccgaa
aggatgcaggagcgctggagcttcaagtcctcctatatttccgacattgaaagcgatgca
ccaggagagtatcgcagctgcaacaaggtcctcagcgaactgggcatcgtgggctgccag
gaaccggacaaggaggcactgcgtttcatctgcgaggcggtgtcctccaggtcggccaag
ttgtgtgcctgcggcctggtcacgatcatcaacaagatgaacatcaacgaggtggtcatc
ggcatcgacggcagcgtgtatcgcttccatcccaagtaccacgatatgctgcagtttcac
atgaagaagctcctcaagccgggcgtcaagttcgaactggttgtctccgaggacggatcc
ggcaggggagccgctctggtggcggccacagctgttcagggcaaggccaagctctaa

DBGET integrated database retrieval system