KEGG   Durio zibethinus (durian): 111298539Help
Entry
111298539         CDS       T05242                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2-like isoform X1
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 111298539
NCBI-ProteinID: XP_022748993
LinkDB All DBs
Position
Unknown
AA seq 2348 aa AA seqDB search
MGSCQNTTLVSEPLHEVAAAEQHSCSESRQNVMLEQRDCIVVDSNGDCAGELGEDENTGC
ERSKDIDFISREGQVVGFGLKELMGDQCFDSTVCLEENQGEIAADVSCSKELMGDMHGDS
AVFLEENQGQSVDGSSSKELMGDRCRNNTVYSNGCQGENMDGSFAEELMSDRCGDITVCS
NENQSKHVDGAASKELIGDNNGDCMICFNENQDENVDASGSKEIMGDRCGDTVVCLNDNQ
GENLDGSGSEKLMGDGDSMGYSNKNLCENVDHSDSKELMVDKDGNQVVCLDKNQGAIDKN
DSETDMLCLKNKVSLVEGGAAALDGSLGLSQDESTASLSSGMEISINCEDQMKDNDENVV
GLMLQEFMDKEGGCLTENQGIIDHHDSENDASQEGELPSELKKMTCCPRNCVKQDKRKDD
ERVSGSIMQGIMEDVVRMTGTDVLKQILPSQKCEVPFELINVTGEHRNKDDPSRCCSYVE
IAMEEKHEILAEIVTKFCNQIPSIQGSNFPSESLAIAGCRSDCSQENDLNDSNIVKGPAL
DGKSGASPLIESDTCSQLSASCCAETISNLQRTGDSVSSCDWHNHKDDLSSSDLSLECFT
KHVEPKSNDDICIELLASQGCLGALEILHRPESLRTWQNAQSDNKNVSGPSGDGVAEVFE
GRNDVTAGTMVEASSEIINAKENACNSKGDSFELGAGCLFDKSASLSCRPIDVVENLSGR
LDPPDLLTKDTCAAISSSSSTDCSGQRENEGKDLVKADCVSETKHDTTTSSSSRRGSRKS
KSSRKNPAKRAARNCRNTKLPHPHESIEFLFKASRRKRSCSSKPARSSIWGLLSNITQFL
EPCPDPVCNEVQNQEPSKAGGGRGSGKRSKNRAGQNSRKSSGLSNTSTSCLRLKIKVGKE
VAPSNLNTVVAEVIDPLVSFDSSFSNYGKETNLQFPKLANVIEDKVELGSEMLFQFKEDQ
EKVKASSDASIMDVKLANKVVGSAENLEKSAEVAANNYCVSQSDAVAEASGEAIEHKYMD
PGTSPDSEVINSIPDAQVGLIHQEESHDTVLNTSGAIAFTGVIKSSKGSKQGKKDNHSSP
RASSIRRPKSSKNCRGRQKATANGFVSSDTLTSSTGANSSRENEPGVSEEAMEVEINMDA
KACCNPDVPDTKNTKNLSSSKHKRNQLYKSSKSQGVSKGKSRISDSVKSRKGNACKLQGD
ELKSVSKSSVKEKGSDEEIVAKGGKHSLTVDAAGNHILDDTEGSNTGNSIASVDMANVDL
VAAGVMEQHTQPDDAWVRCDDCHKWRRIPVALVKSIDEACRWICGDNRDKAFADCSIPQE
KSNADINTELGISDAEEDGCDGFNNKELEKGFESKRMTVPPLSHFWRIDSNQFLHRGRKT
QTIDEIMVCHCKRPPDGKLGCGDECLNRMLNIECVQGTCPCGDLCSNQQFQKRKYAKMKW
DRFGKKGFGLRILENISAGHFLIEYVGEVLDMQSYEARQKEYASRGQRHFYFMTLNGSEV
IDAYVKGNLGRFINHSCDPNCRTEKWMVNGEICIGLFAVRDIKKGEEVTFDYNYVRVFGA
AAKKCHCGSPHCRGYIGGDPLSAEVIVHDDSDEESPEPEMLEDGETWNGSDKIISGSSSF
DGAAMQSVGSVITGGVIKLENKPEAEDSVDRSAFATSKLNSSVETEDFKGNFQVAIQPEV
LPMTVPCEAVQPDGTTEQKAMNKTPSSIQKLDTSLNVSDNKLSSDIVDANKKSKFDTAED
KQVPRKSRPMMKTCRSSGSIKKGKNSSNSLNGNKVQITSIKSQVPSVKPKKFLENSSTCR
FETVEEKLNELLDSEGGITKRKDASKGYLKLLLLTATSGDSGNGEAIQSNRELSMILDAL
LKTKSRLVLTDIINKNGLQMLHNIMKKYRRDFKKIPILRKLLKVLEYLAMREILTLEHIN
GGPPCAGRESFRESILSFTEHDDKQVHQIARNFRDRWIPKPVRKLSYRDKDEGRMEFHRG
LDCNKVSAAHNHWRDQAIRPTEAISCIMQTTVATTSVDTSAREGCSSSSTGVSQTNGTKI
RKRKSRWDQPADTEKIDSPSPKKLEYSPLPVLVQSMPDHTDKMSRGDKECPEFVCKGEAI
NFDNGRNSFQDDVPPGFSSPSNASMVSSTAPSTATDFPQPKFSQLKYSDMIVAHPQKRFI
SRLPVSYGIPLHILQQFGSPQGESVESWVIVPGMPFHPFPPLPPCPRDKKDTPPACAANS
NGIKQDLEERQDSRQPATSYLDENIHSAAGGNPPDTDIPVTNIQQAFKRTRESSYDLGKK
YFRQQKRKGPPWRKSECMGNNHIGVTSCTDVVNVKNELRNSYYSDDITYSVGEGRGDFYQ
QPQHPNQH
NT seq 7047 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtgccagaatacgactttggttagcgaacctttgcatgaagttgctgctgca
gagcaacattcgtgctcagagtcaaggcaaaacgttatgcttgagcagcgggattgcatt
gtagttgattctaatggggattgtgccggtgaactgggtgaagatgaaaataccggttgt
gaaaggtctaaggatattgatttcatctcgcgagagggccaagtggttggttttggtttg
aaagaattgatgggtgatcaatgttttgacagcacagtttgtttggaagaaaatcagggt
gaaattgctgctgatgtttcttgttcaaaagaattaatgggtgatatgcatggtgatagt
gcagtttttttggaagaaaatcagggtcaaagtgtggatggttctagttcaaaggaattg
atgggtgataggtgcaggaacaacacagtttactcaaatggttgtcagggtgagaacatg
gatggttcttttgcagaggagctgatgagtgataggtgtggtgatattacagtttgttcc
aatgaaaatcagagtaagcatgtagatggtgctgcctcaaaggaattgattggtgacaac
aatggtgattgcatgatatgctttaatgaaaaccaggatgagaatgtggatgcttctggt
tcaaaggaaataatgggtgataggtgtggtgatactgtcgtttgtttgaatgataatcaa
ggtgaaaatctagatggttctgggtcagagaaattgatgggtgatggtgatagcatgggt
tattcaaataaaaatttgtgtgaaaatgtagaccattctgattcaaaggaattgatggtt
gataaggatggtaatcaagtggtttgtttagacaagaatcagggtgccattgataaaaat
gattctgaaactgatatgttgtgcttgaaaaacaaagtatctttggttgagggtggtgca
gctgctctggatggatctttaggcttgtctcaggatgaaagtactgctagtttgagcagt
ggcatggagatttctataaactgtgaagatcagatgaaagacaatgatgaaaatgtggtt
ggcttgatgttacaagaatttatggacaaagaaggtggttgtttgactgagaatcagggt
ataattgatcatcatgactcagaaaatgatgcttcacaggagggtgaactgccatcagaa
ctgaaaaagatgacttgttgtccccgaaattgtgttaagcaggataagcggaaggatgat
gagagggtcagtggttccattatgcaagggatcatggaagatgtggtaaggatgacaggg
acagacgttctgaaacaaatattgccttcacagaaatgtgaagtgccctttgagttaatt
aatgtaactggtgaacacaggaataaggatgatccaagtagatgttgttcctatgtggaa
atagctatggaagaaaaacacgagatattagctgagatcgtgactaaattttgcaaccaa
attccatctattcagggtagtaactttccttcagaatcattagccattgctggttgcagg
agtgattgttcccaagaaaatgacctgaacgatagtaacattgtcaaaggtcctgctctg
gatgggaaaagtggtgcttcacccttaatagaatctgatacgtgcagccagctatcagct
tcatgttgtgctgagaccatttccaacttacaacgtacaggtgattcagtgagtagttgt
gactggcataaccacaaagatgatttgagtagcagtgatctctcattggaatgttttact
aagcatgtggaacctaaaagtaatgatgatatatgcattgagttattggcttcacagggt
tgcctaggtgcattggaaatcttacataggcctgaatcattgcgcacgtggcagaatgca
caatctgacaataagaatgttagtggtccatcaggagatggtgttgctgaggtttttgag
gggaggaatgatgttactgcaggtacaatggttgaagcttccagtgaaataataaatgcc
aaagaaaatgcctgcaactcaaagggtgattcttttgagctaggtgcaggctgtcttttt
gataaatcagcttcgttgtcatgtcggcccattgatgttgttgaaaacctgtctgggagg
ttggatccaccggatcttttgacaaaggatacttgtgctgcaattagttctagcagttca
actgactgttccggacaaagagaaaatgaaggaaaggatcttgtcaaggccgattgtgtt
tcagaaactaaacatgatactaccacatcttcctcttctcgaaggggcagccggaaaagt
aaatcgagcagaaaaaatcctgcaaaaagggctgctaggaactgcaggaacacaaagctg
ccacacccacatgaaagtattgaattccttttcaaagcttcaagaaggaaaagaagctgt
tcatccaaacctgctcgttcttctatctggggattgctcagtaatattacacaatttctt
gagccatgtcctgaccctgtttgtaatgaagtgcagaatcaagaaccgtccaaagctggg
ggtgggcgaggaagtgggaaacgaagcaaaaatcgggctggtcaaaacagcagaaagtca
agtgggctaagtaacacttcaaccagttgtctacgtttgaagattaaagtgggcaaggaa
gttgctccaagtaatctgaacactgtggttgcagaagtgattgatccgttagtttctttt
gattcttcttttagtaattatgggaaggaaacaaatttacaatttccaaaattagccaat
gttattgaagataaagtagaactgggtagtgaaatgctgtttcagttcaaggaggaccaa
gaaaaggtgaaagcaagctcagatgcttctattatggatgtaaaactagcaaataaagtt
gtggggagtgctgaaaatcttgaaaagtctgctgaagttgctgcaaataattactgtgta
agtcagtctgatgctgtggctgaagcatctggagaagcaatagaacacaagtatatggat
cctggaacttcaccagattcagaagtaatcaattcaattcctgatgctcaagttggttta
atacaccaagaagagtcgcatgatactgttttgaatacttctggagctattgcttttact
ggagttattaagagtagcaagggtagcaagcagggaaagaaggataatcatagttcccct
cgtgcatccagcataaggagacctaaatcatcaaagaattgcagaggcaggcaaaaagca
acagctaatggatttgtctctagcgacactcttacttcatccactggtgcaaattcttca
agagagaatgagcctggagtctccgaagaggccatggaagtggaaattaatatggatgct
aaagcatgttgcaatcctgatgttccagatacaaagaacactaagaatttgtcttcctct
aaacacaagcggaatcaactttacaaaagttcaaaatctcagggagtgagcaagggaaag
tccagaatctctgattcagtgaagagcaggaaaggaaatgcttgtaagctgcagggagat
gagttaaagtctgttagtaagagcagcgtaaaggagaaaggctctgatgaagagattgta
gctaaaggaggaaagcactcactaacagttgatgctgcaggaaatcacattttggatgat
actgagggatcaaatactggcaacagtattgcatctgtagacatggctaatgttgacttg
gtagctgctggtgtcatggagcagcatacacagcctgatgatgcttgggtgcgttgtgat
gattgtcataaatggcggcgaataccagttgcacttgtaaagtcaattgatgaggcgtgc
cgttggatctgtggggacaacagggataaagcatttgctgattgctcaatccctcaagag
aagtccaatgcagatattaatactgagttgggcatatcagatgctgaggaagatggttgt
gatggtttcaataataaggaactggaaaagggatttgaaagtaaacgaatgacagtgcca
ccactgtcacatttttggcgtattgatagtaaccaatttttgcaccgtggccgtaaaact
caaaccattgatgagataatggtttgccattgcaaacgacctccagacggtaagcttggc
tgtggagatgaatgcctaaaccgaatgctgaacattgaatgtgttcaaggcacctgtcca
tgcggggacctttgttcaaatcaacagttccagaagcgcaaatatgcaaagatgaagtgg
gacagatttggtaagaaaggttttgggctgaggatacttgagaatatatctgctggccat
ttccttattgaatacgttggagaggtgcttgatatgcaatcttatgaggctcgacaaaag
gagtatgcttctaggggtcagaggcatttctatttcatgacattgaatggcagtgaggtt
atagatgcatatgtcaaaggaaatttggggcgcttcattaaccatagttgtgatcccaat
tgtcgtactgaaaagtggatggtgaatggagaaatttgtattggactgtttgcagtgagg
gatataaagaagggtgaagaggttacatttgactacaactatgtgagggtatttggagct
gctgctaaaaaatgtcattgtggttcacctcattgtcggggttatataggtggagatcca
cttagtgccgaagtaattgttcatgatgattcagatgaagaatctcctgaacctgagatg
cttgaagatggtgaaacctggaatggttctgacaaaattatatctggatctagttccttt
gatggtgcagcgatgcaatctgtggggagtgtaataactggtggtgttataaaattggag
aataaaccagaagctgaggactctgtggatcgttctgcttttgccacatctaaattgaac
agttcagttgaaacagaagattttaagggaaatttccaagtagccattcagccagaggtt
ttgcctatgacagttccctgtgaagctgttcagcctgatggtaccacagaacagaaggct
atgaacaaaaccccatcttccattcagaaattagatacttctctaaatgtgtcagacaac
aaattatcttctgatattgttgatgctaataaaaagtcaaagtttgatacagcagaagac
aaacaggttcctagaaaatctcgccccatgatgaagacttgtcgttcatccggctctatt
aagaaggggaaaaatagtagtaattctctgaatggaaataaggttcagataacatctatc
aaatctcaagtgccttctgtcaaacccaaaaaatttttggaaaattccagtacttgccgc
tttgaaacagtggaggagaaacttaatgaattgctggattctgagggggggataacaaaa
cgaaaggatgcttctaagggctacttgaagcttctgcttctcacggcaacttctggtgat
agtggcaatggtgaagcaattcaaagcaatcgagagctttcaatgattcttgatgcactt
ttaaaaacaaaatcacgacttgtgctgaccgatataattaacaagaatggtttgcagatg
ctacacaacataatgaagaaatacagaagggacttcaaaaagattccgattcttcgaaag
cttctaaaggttttagagtatttagcaatgagggagatacttactctggaacatataaat
ggaggtcctccctgtgctggaagggagagctttagggagtctatactgtcattcacagag
catgatgacaaacaggtccatcaaattgcccgaaattttcgagatagatggattccaaaa
cctgtcagaaaacttagctacagggacaaggatgagggcaggatggagtttcacaggggt
ttggactgtaacaaggtttcagcagcgcacaatcattggcgcgaccaggctataagaccc
actgaggcaattagttgtatcatgcaaaccacggttgccacaacttcagtggatacttct
gcccgtgagggttgctcctcatcttccacaggtgtttcccaaaccaatggcaccaaaatt
cgcaagcgtaaaagccgttgggatcagccggcagatacagagaaaattgattcaccgtca
ccaaagaaacttgaatatagcccattacctgttttagttcaatcaatgccagatcacaca
gacaagatgagtagaggggataaagaatgtcctgaatttgtttgcaaaggtgaagctatt
aattttgacaatggaaggaacagttttcaggacgatgttccaccggggttctcatctcct
tccaatgcatctatggtttcatctactgctccatcaactgctactgatttccctcaacca
aaattttctcagttgaagtattctgatatgattgtggctcatccacagaagagattcatt
tcccgtttgcccgtctcatatggaattcccttgcacattttgcagcagtttggatcacca
cagggtgaaagtgtagagagttgggtaattgtccctggcatgcctttccacccttttcca
cctttacctccatgtccccgtgataagaaagacactccacctgcttgtgctgctaactcc
aatggaattaaacaagatttagaagagcgacaagacagccgtcaacctgccactagttat
cttgatgaaaatattcatagcgcagctggtggtaacccaccagatacagacattcctgtt
actaacatccaacaggcatttaaaagaacgagggaatcctcgtatgatctgggtaagaag
tacttcagacagcagaaacgaaaagggcctccctggcgtaagtctgaatgcatgggaaac
aaccatataggtgtgacaagctgcactgatgtagttaatgtaaaaaatgagctgagaaat
tcttattactcagatgatataacctatagtgttggagaaggtcgcggtgatttttatcag
caaccacagcacccaaatcaacattga

DBGET integrated database retrieval system