KEGG   Enterobacter aerogenes KCTC 2190: EAE_22820Help
Entry
EAE_22820         CDS       T01529                                 

Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_22820
   01230 Biosynthesis of amino acids
    EAE_22820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_22820
   00620 Pyruvate metabolism
    EAE_22820
  Nucleotide metabolism
   00230 Purine metabolism
    EAE_22820
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     EAE_22820
Exosome [BR:eae04147]
 Exosomal proteins
  Proteins found in most exosomes
   EAE_22820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
4854110..4855552
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGTPEDHQLRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKIFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTDKDKA
DIVTAAKIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCDQDAMDDVI
LASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRSVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSLNVSKHRLDVQFDN
VEEAIAMSAMYAANHLKGITAIITMTESGRTALMTSRISSGLPIFALSRHERTLNLTALY
RGVTPVHFDSHNDGVAAAHDAVNLLRDKGYLVSGDLVVVTQGDVMSTIGSTNTTRILTVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaggcttcgcagaaccaaaatcgtaacgaccttaggcccagcaactgaccgc
gataacaacctcgaaaaagttatcgccgcgggcgctaacgtcgtacgcatgaacttctct
cacggtaccccggaagatcaccaactccgcgcagacaaagtccgtgaaattgcagcaaaa
ctgggccgtcacgttgcgattctcggcgacctgcaggggccgaaaatccgcgtctctacc
ttcaaagaaggcaaaattttcctcaacattggcgacaaattcctgctcgacgccaacctg
ggtaaaggcgaaggcgataaagaaaaagtcggcatcgactataaaggcctgccggcggac
gtcgttccaggcgatatcctgctgctcgacgatggacgcgtgcagttgaaggttctggaa
gtacaggggatgaaagttttcaccgaagttaccgttggtggcccgctatctaacaataaa
ggtatcaacaaactcggcggcgggctgtctgcagaagcgttaaccgataaagacaaagcc
gacatcgttaccgccgcaaaaattggcgttgattacctggcggtctccttcccgcgctgc
ggcgaagacctgaactacgctcgccgtctggcccgtgacgctggctgcgatgcaaaaatc
gtcgctaaagtcgagcgtgcggaagcggtctgcgaccaggatgccatggacgacgttatt
ctcgcctccgatgtggtgatggtagctcgaggcgatctcggtgtggaaatcggcgatccg
gaattggtgggtatccagaaggcgctgatccgccgcgctcgccagcttaaccgctcggtc
atcaccgccacgcagatgatggaatcaatgattaccaatccgatgccgacccgcgcggaa
gtcatggacgtggcgaacgccgtactggacggtaccgatgccgtgatgctctccgcggaa
accgctgccggccagtatccgtctgaaaccgtcgccgcgatggcgcgggtgtgcctgggc
gcggagaagatcccaagtctcaacgtttccaaacaccgtcttgacgtccagttcgacaat
gtcgaagaagcgattgccatgtcggcaatgtatgcggccaaccacctgaaaggcattacc
gcgattatcaccatgaccgagtccggccgcaccgcgttgatgacttcacgtatcagctcc
ggactgccaattttcgccctctcccgtcacgagcgtactctgaacctgacggcgctctat
cgtggcgtaacgccggtgcatttcgacagccataacgacggcgttgccgccgcgcacgac
gcggttaacctgctgcgtgataaaggctatctggtctccggcgacctggtggtcgtcacc
cagggcgacgtgatgagcaccatcggcagcaccaacaccacccgtatcctgaccgttgag
taa

DBGET integrated database retrieval system