KEGG   Klebsiella aerogenes KCTC 2190: EAE_22820Help
Entry
EAE_22820         CDS       T01529                                 

Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00230  Purine metabolism
eae00620  Pyruvate metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
eae01230  Biosynthesis of amino acids
Module
eae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eae_M00002  Glycolysis, core module involving three-carbon compounds
eae_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
eae_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_22820
   00620 Pyruvate metabolism
    EAE_22820
  Nucleotide metabolism
   00230 Purine metabolism
    EAE_22820
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     EAE_22820
Membrane trafficking [BR:eae04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EAE_22820
Exosome [BR:eae04147]
 Exosomal proteins
  Proteins found in most exosomes
   EAE_22820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-GeneID: 10794780
NCBI-ProteinID: YP_004594742
UniProt: A0A0H3FUK2
LinkDB All DBs
Position
4854110..4855552
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGTPEDHQLRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKIFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTDKDKA
DIVTAAKIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCDQDAMDDVI
LASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRSVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSLNVSKHRLDVQFDN
VEEAIAMSAMYAANHLKGITAIITMTESGRTALMTSRISSGLPIFALSRHERTLNLTALY
RGVTPVHFDSHNDGVAAAHDAVNLLRDKGYLVSGDLVVVTQGDVMSTIGSTNTTRILTVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaggcttcgcagaaccaaaatcgtaacgaccttaggcccagcaactgaccgc
gataacaacctcgaaaaagttatcgccgcgggcgctaacgtcgtacgcatgaacttctct
cacggtaccccggaagatcaccaactccgcgcagacaaagtccgtgaaattgcagcaaaa
ctgggccgtcacgttgcgattctcggcgacctgcaggggccgaaaatccgcgtctctacc
ttcaaagaaggcaaaattttcctcaacattggcgacaaattcctgctcgacgccaacctg
ggtaaaggcgaaggcgataaagaaaaagtcggcatcgactataaaggcctgccggcggac
gtcgttccaggcgatatcctgctgctcgacgatggacgcgtgcagttgaaggttctggaa
gtacaggggatgaaagttttcaccgaagttaccgttggtggcccgctatctaacaataaa
ggtatcaacaaactcggcggcgggctgtctgcagaagcgttaaccgataaagacaaagcc
gacatcgttaccgccgcaaaaattggcgttgattacctggcggtctccttcccgcgctgc
ggcgaagacctgaactacgctcgccgtctggcccgtgacgctggctgcgatgcaaaaatc
gtcgctaaagtcgagcgtgcggaagcggtctgcgaccaggatgccatggacgacgttatt
ctcgcctccgatgtggtgatggtagctcgaggcgatctcggtgtggaaatcggcgatccg
gaattggtgggtatccagaaggcgctgatccgccgcgctcgccagcttaaccgctcggtc
atcaccgccacgcagatgatggaatcaatgattaccaatccgatgccgacccgcgcggaa
gtcatggacgtggcgaacgccgtactggacggtaccgatgccgtgatgctctccgcggaa
accgctgccggccagtatccgtctgaaaccgtcgccgcgatggcgcgggtgtgcctgggc
gcggagaagatcccaagtctcaacgtttccaaacaccgtcttgacgtccagttcgacaat
gtcgaagaagcgattgccatgtcggcaatgtatgcggccaaccacctgaaaggcattacc
gcgattatcaccatgaccgagtccggccgcaccgcgttgatgacttcacgtatcagctcc
ggactgccaattttcgccctctcccgtcacgagcgtactctgaacctgacggcgctctat
cgtggcgtaacgccggtgcatttcgacagccataacgacggcgttgccgccgcgcacgac
gcggttaacctgctgcgtgataaaggctatctggtctccggcgacctggtggtcgtcacc
cagggcgacgtgatgagcaccatcggcagcaccaacaccacccgtatcctgaccgttgag
taa

DBGET integrated database retrieval system