KEGG   Klebsiella aerogenes KCTC 2190: EAE_24495Help
Entry
EAE_24495         CDS       T01529                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     EAE_24495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5223518..5224147
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAQLAYRLIHVDIGKGEQFRPQFLAISPNNKIPAIVDHVP
VDGGAPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
HAPQAVPYAIERYQVESQRLYGVMNRRLETSPWLGGEHYSIADIACWPWVNAYPRQRIDL
SQFPAVHNWFERIRQRPATQQALLKTQHY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactacgcacctacccccaacggccacaaaatcactctttttctcgaa
gaggcgcagctggcctatcgcctgatacacgtcgatatcggcaaaggtgaacagtttcgc
ccgcagtttctggctatctcgccaaataataagatcccggcgatcgttgaccacgttccg
gtcgacggcggcgcgccgttaagcctgtttgagtcaggagagatcctgctctatctggcg
gagaaatcgggaaaattactaagcggcgagctgcgcgagcggcatactaccctgcaatgg
ctattctggcaggtcggcggtctggggccaatgcttgggcaaaaccaccactttaaccat
cacgcgcctcaggctgtcccttacgccattgaacgctatcaggtcgaaagccagcgcctg
tatggcgtaatgaaccggcgtcttgaaaccagtccatggttgggcggcgagcactacagt
atcgccgatatcgcctgttggccatgggttaatgcctacccgcgccaacgcatcgatctt
agccagttcccggcggtgcataactggtttgaacgcatccgccagcgcccggcaacgcaa
caagcgctactcaaaacgcaacattattaa

DBGET integrated database retrieval system