KEGG   Ensifer adhaerens Casida A: FA04_16580Help
Entry
FA04_16580        CDS       T04507                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
eah  Ensifer adhaerens Casida A
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FA04_16580
  Amino acid metabolism
   00310 Lysine degradation
    FA04_16580
   00380 Tryptophan metabolism
    FA04_16580
Enzymes [BR:eah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FA04_16580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3412674..3415670)
Genome map
AA seq 998 aa AA seqDB search
MTRQEANEQFQLTSFLDGANAAYIEQLHARYEADPASVSAEWQAFFKALADRPEDVVKAA
KGASWKKNNWPIPANGELVSALDGDWGTVEKVIEKKVKAKAEEAAAATGTVASAADIHQA
TRDSVRAIMMIRAYRARGHLHAKLDPLGLAAPVEDYNELSPSNYGFEDKDLDRKIFIDNV
LGLEYATLREMVEILERTYCSTIGVEFMHMSNPEEKGWIQERIEGPDKGVDFTPEGKKAI
LQKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIIKRGGQEGLKEIVLGMAHRGR
LNVLSQVMAKPHRAIFHEFKGGSYAPDDVEGSGDVKYHLGASSDREFDGNKVHLSLTANP
SHLEIVNPVVMGKARAKQDQMATVFEGDIIPLRERSKVMPLLLHGDAAFAGQGVIAEILG
LSGLRGHRVAGTVHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVY
AAKIATEFRMKFHKPVVIDMFCYRRFGHNEGDEPAFTQPKMYKVIRAHRTVVQVYSDRLI
AEGLISEGEVEKMKADWRAHLEQEFEAGQSYKPNKADWLDGVWSGLRSADNQDEQRRGKT
SVPMKQLKEVGRKISEIPAGFSAHRTIQRFMENRANMIQTGEGVDWAMAEALAFGTLVTE
GTKIRLSGQDCERGTFSQRHSVLYDQQSEERYIPLANLSPTQARYEVINSMLSEEAVLGF
EYGYSLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGP
EHSSARLERFLQLCAEDNMQVANVTTPANYFHILRRQVKRDFRKPLILMTPKSLLRHKRA
ISSLSEMAGESSFHRLLWDDAEVIKDGPIKLQKDSKIRRVVLCSGKVYYDLLEEREKRGI
DDIYLLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDA
KYQRVRYTGRPAAASPATGLMSKHLAQLAAFLEDALGG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcaagaggccaacgagcaattccagctcacttcgtttctggacggcgccaac
gccgcctatatcgagcagctccatgcacgctacgaggcggacccggcgtccgtgtcggct
gaatggcaggccttcttcaaggcgctcgccgaccggccggaagatgtggtgaaggcagcc
aagggcgcctcctggaaaaagaacaactggccgatcccggccaatggcgaactggtctcg
gcgctcgatggcgactggggcacggtcgagaaggtcatcgagaagaaggtcaaggcgaag
gccgaggaagcggcggccgccaccggcaccgtcgccagcgctgccgacatccaccaggcg
acgcgcgattccgtccgcgccatcatgatgatccgcgcctatcgcgcccgcggccacctg
catgccaagctcgacccgctcggcctggctgccccggttgaagactacaacgagctttcg
ccctcgaactacggtttcgaggacaaggatctcgaccgcaagatcttcatcgacaacgtg
ctcggtcttgaatacgcgaccctccgtgagatggtcgaaatcctcgagcgcacctactgc
tcgacgatcggcgtcgagttcatgcacatgtccaacccggaagagaagggctggatccag
gagcgcatcgaaggtccggacaagggcgtcgacttcacgcctgaaggcaagaaggcgatc
ctgcagaagctgatcgaggccgaaggcttcgagcagttcatcgacgtcaagtacaagggc
accaagcgcttcggtctcgacggcggtgagtcgctcattccggcgctcgagcagatcatc
aagcgcggcggccaggaaggcctcaaggaaatcgtgctcggcatggcccatcgcggccgt
ctgaacgtgctttcccaggtcatggcaaagccgcaccgcgccatcttccacgagttcaag
ggcggctcctacgcgcctgacgacgtcgaaggttcgggcgacgtgaagtaccacctcggt
gcgtcttccgaccgcgaattcgacggcaacaaggttcacctgtcgctgacggcaaacccg
tcgcacctggaaatcgtcaaccctgtggtcatgggcaaggcacgcgccaagcaggaccag
atggcgaccgtctttgaaggcgacatcattccgctgcgcgaacgctccaaggtcatgccg
ctgctgctgcatggtgacgccgcttttgccggccagggcgtgattgctgaaatcctcggg
ctttccggcctgcgcggtcaccgcgttgccggtacggtccacttcatcatcaacaaccag
atcggcttcaccaccaatccggccttctcgcgctcgtcgccctatccgtccgacgtcgcc
aagatgatcgaagcgccgatcttccacgttaacggcgacgatccggaagcggttgtctac
gcggccaagatcgccaccgaattccggatgaagttccacaagcctgtcgtcatcgacatg
ttctgctatcgccgcttcggccacaacgaaggcgacgagccggcgttcacgcagccgaag
atgtacaaggtcatccgcgcccacaggaccgtcgtccaggtctactccgaccgcctgatc
gccgaaggcctgatttccgaaggcgaagtcgagaagatgaaggccgactggcgtgcgcat
ctcgaacaggagttcgaggccggccagtcctacaagccgaacaaggccgactggcttgac
ggtgtctggtcgggcctgcgctcggccgacaaccaggacgaacagcgccgcggcaagacc
tcggtgccgatgaagcagttgaaggaagtcggccgcaaaatctccgagatcccggctggt
ttcagcgcgcaccgcacgatccagcgcttcatggaaaaccgcgccaacatgatccagacc
ggcgagggtgtcgactgggccatggctgaggcgctcgctttcggcacgctggtcacggaa
ggcaccaagatccgcctgtcgggtcaggactgcgaacgcggcaccttctcgcagcgccac
tcggtgctctacgatcagcagtcggaagagcgctacatcccgctcgcaaacctgtcgccg
acccaggcgcgctacgaagtcatcaactcgatgctttcggaagaggcagttctcggcttc
gagtacggctactcgctcgcccgtccgaacgcgctcaccctctgggaagctcagttcggc
gacttcgccaacggtgcgcaggtcgtcttcgaccagttcatctcgtcgggcgaacgcaag
tggctgcgcatgtcgggtctcgtctgcctgctgccgcacggctatgaaggccagggtccg
gagcactcgtctgctcgcctggaacgcttcctgcagctttgcgcggaagacaacatgcag
gtcgccaacgtcacgacgccggcgaactacttccacatcctgcgccgccaggtgaagcgc
gacttccgcaagccgctgatcctgatgacgccgaagtcgctgctgcgtcacaagcgtgcg
atctccagcctgtcggaaatggccggcgagagctcgttccaccgcctgctgtgggacgat
gccgaggtgatcaaggacggcccgatcaagctgcagaaggactcgaagatccgtcgcgtc
gtgctctgctcgggcaaggtctactacgacctgctcgaagaacgcgaaaagcgcggcatc
gacgacatctacctgctgcgcgtcgaacagctctatccgttcccggccaaggcgctcatc
aacgagctcagccgcttccgcaacgcggagatggtctggtgccaggaagagccgaagaac
atgggcgcttggtcgttcatcgacccgtacctcgaatgggttctcgcccatatcgacgcc
aagtatcagcgcgtgcgctacaccggccgtccggctgccgcatcgccggcgaccggcctg
atgtcgaagcacctggcgcagcttgccgccttcctcgaggacgcgctggggggctga

DBGET integrated database retrieval system