KEGG   Ensifer adhaerens Casida A: FA04_19835Help
Entry
FA04_19835        CDS       T04507                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eah00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FA04_19835
Enzymes [BR:eah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FA04_19835
Transporters [BR:eah02000]
 Other Transporters
  Pores ion channels [TC:1]
   FA04_19835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_C_3 GST_N_4 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ANK75005
LinkDB All DBs
Position
pCasidaAA:complement(20366..20977)
Genome map
AA seq 203 aa AA seqDB search
MKLYRHPLSGHSHRAQLFLSLLGVPHELIDVDLKARAHKAPEFLALNPFGQVPVLDDEGT
VIADSNAILVYLAKKLGRIDWLPEDPASAAKVQKWLSVAAGDIAFGPAAARLVTVFGANL
DAEGAISRAHRVLAQIDAELAGHDFLVGARPTIADVALYSYVSAAPEGNVDLSDYAHVRA
WLSRIERLPGFVGFEKTAVGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctaccgccatccgctctccggccactcgcacagggcgcagcttttcctgtcg
ctgctcggcgtgccgcacgagctgatcgacgtcgacctcaaggcgcgggcacacaaggcg
ccggaattcctcgcgctcaatcccttcggtcaggttccggtgctcgacgacgaaggcacg
gtcatcgccgacagcaacgccatcctcgtctacctcgccaagaagctcggccgcatcgac
tggctgccggaagatccggcctcggcggcgaaggtgcagaaatggctctcggttgccgct
ggcgacatcgcctttggtccggcagccgcgcgtctcgtcacggtcttcggcgccaatctg
gatgcagaaggggctatctccagggcccaccgggtgcttgcacagatcgatgcggagctt
gccggccacgacttcctcgtgggcgcaaggccgaccatcgccgacgtcgccctctacagc
tacgtgtcggcagcaccggaaggcaatgtcgacctttccgactacgcccatgttcgtgcc
tggctttcgcgcatcgagcgcctgcccggcttcgtcggctttgagaagaccgccgtcggc
ctcgccgcctga

DBGET integrated database retrieval system