KEGG   Ensifer adhaerens Casida A: FA04_22680Help
Entry
FA04_22680        CDS       T04507                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eah  Ensifer adhaerens Casida A
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eah00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FA04_22680
   00650 Butanoate metabolism
    FA04_22680
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FA04_22680
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FA04_22680
Enzymes [BR:eah01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FA04_22680
Amino acid related enzymes [BR:eah01007]
 Aminotransferase (transaminase)
  Class III
   FA04_22680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
pCasidaAA:complement(678974..680242)
Genome map
AA seq 422 aa AA seqDB search
MTSLPDRKNAAISRGVGMTTQIYADRAENSEIWDKEGNRYIDFASGIAVVNTGHRHPKVI
EAVKAQIDRFTHTCHQVVPYESYVHLAERLNALTPGDFAKKTIFVTTGAEAVENAVKIAR
ASTGRQAVIAFSGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHAPFPIELHGVTTEQS
LAALKKLFAADVDPGRVAAIILEPVQGEGGFYPAPAAFMKALREICDQHGILLIADEVQT
GFARTGKMFAMDHHDVAPDLITMAKSLAGGFPLAAVTGRAEVMDAPAPGGLGGTYGGNPL
GIAAAHAVLDVIAEEKLCERAEQLGGRLKQRLAAIREQAPEIADIRGPGFMNAVEFNDVK
TNLPSADFANKVRLIALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDILEASILAA
RA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctccccgaccgcaagaacgccgccatctcgcgcggcgtcggcatgaccacc
cagatctacgccgaccgcgcggaaaattcggaaatctgggacaaggaaggcaatcgctac
atcgacttcgcctccggcatcgcggtcgtcaataccggccatcgccacccgaaggtgatc
gaggcggtcaaggcgcagatcgatcgcttcacccacacctgccaccaggtcgttccctac
gaatcctacgtgcatctcgccgagcgcctcaatgcactgacgcccggcgacttcgccaag
aagaccatcttcgtgaccaccggcgccgaagccgtggaaaacgccgtcaagatcgcccgc
gcctcgacaggccgtcaggcggttatcgccttcagtggcggcttccacggccggaccttc
atgggcatggcgctcaccggcaaggtcgttccctataaggtcggcttcggcgcgatgccg
ggcgacgtcttccacgcccccttcccgatcgaattgcacggcgtcaccaccgaacagtcg
ctcgctgcgctgaagaagctctttgccgccgacgtcgatccgggtcgcgtcgccgcgatc
attctcgagcccgtgcagggcgaaggcggcttctatccggcgcctgccgccttcatgaag
gcgctgcgcgaaatttgcgaccagcacggcattctcttgatcgccgacgaagttcagacc
ggctttgcccgtaccggcaagatgtttgccatggaccaccatgatgtcgcgcccgatctc
atcaccatggcgaaaagcctcgccggcggcttcccgcttgccgccgtcaccggccgcgcc
gaagtcatggatgctccagcgccgggcggccttggcggcacctatggcggcaacccactc
ggcatcgccgcagcgcacgccgtccttgacgttatcgctgaggagaagctctgcgagcgc
gccgagcagcttggcggccggctgaagcagcggcttgccgcaatccgcgagcaggcgccc
gaaatcgccgacatccgcggccccggcttcatgaacgccgtcgagttcaacgacgtgaag
accaacctgccgagcgctgactttgccaacaaggtgcgcctgatcgctctggaaaagggc
ctgatcctgcttacctgcggtgtgcacggcaacgtcatccgcttcctggcgcccatcacc
atccaggacgaagtcttcgccgaagcgctcgacattctcgaagcgtcgatcctcgcagcg
cgtgcttga

DBGET integrated database retrieval system