KEGG   Equus asinus (ass): 106827436Help
Entry
106827436         CDS       T04645                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
eai  Equus asinus (ass)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106827436 (SUV39H1)
Enzymes [BR:eai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106827436 (SUV39H1)
Chromosome [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106827436 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106827436 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgtagtgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgcccttggcatctccaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattataagaagatccgcgaacaggagtattac
ctggtaaaatggcgtggctacccagactcagagagcacctgggagccacggcagaacctc
aagtgtgtgcgcatcctcaagcagttccacaaggacttagaaagggagctgctccggagg
caccaccggtcaaagccgccccggcacctggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcgctccggcgctgggagcaggagctcaatgccaagcgcagc
catctgggacgcatcaccgtggagaacgaggtggacctggacggccccccgcgggccttc
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggccgtgggc
tgcgagtgccaggactgtctgtgggcacccgctggaggctgctgccccggggcgtccctg
cacaagtttgcctacaatgaccagggccaggtgcggctgcgggccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgccccaatcgcgtggtccagaagggc
atccgctatgacctctgcatcttccgcacggacgatggacgcggctggggtgtccgcacg
ctggagaagatccgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcggcggggccagatctacgaccgccagggtgccacctacctcttcgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctattatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcgactgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccccaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system