KEGG   Equus asinus (ass): 106827436Help
Entry
106827436         CDS       T04645                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
eai  Equus asinus (ass)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106827436 (SUV39H1)
Enzymes [BR:eai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106827436 (SUV39H1)
Chromosome [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106827436 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106827436 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgtagtgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgcccttggcatctccaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattataagaagatccgcgaacaggagtattac
ctggtaaaatggcgtggctacccagactcagagagcacctgggagccacggcagaacctc
aagtgtgtgcgcatcctcaagcagttccacaaggacttagaaagggagctgctccggagg
caccaccggtcaaagccgccccggcacctggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcgctccggcgctgggagcaggagctcaatgccaagcgcagc
catctgggacgcatcaccgtggagaacgaggtggacctggacggccccccgcgggccttc
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggccgtgggc
tgcgagtgccaggactgtctgtgggcacccgctggaggctgctgccccggggcgtccctg
cacaagtttgcctacaatgaccagggccaggtgcggctgcgggccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgccccaatcgcgtggtccagaagggc
atccgctatgacctctgcatcttccgcacggacgatggacgcggctggggtgtccgcacg
ctggagaagatccgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcggcggggccagatctacgaccgccagggtgccacctacctcttcgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctattatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcgactgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccccaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system