KEGG   Equus asinus (ass): 106828486Help
Entry
106828486         CDS       T04645                                 

Gene name
ASH1L
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
eai  Equus asinus (ass)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
  Amino acid metabolism
   00310 Lysine degradation
    106828486 (ASH1L)
Enzymes [BR:eai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106828486 (ASH1L)
Chromosome [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106828486 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 2963 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAISTGSLVSKREVELENNTKEEEDVRKWNRERNIET
GKDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKAGDVAAIECQSEESIHLHSQGENNPLSKKLSP
VHSEMTDYLNATSSTLVGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKASVGSVAGIIHKDLIKKPAISTAVGLVTKDPGKKPVFNAAVGLV
SKDSVKKLGTGTTAVFINKDLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVNKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVTNSTMGLVNKDIGKKLVSCPMAGLVSKD
AINLKAEALLPTQEPLKASCSTNINSLESQELSESLKDNATSKTFEKNVIRQSKESLLEK
FSVRKEIINLEKEIFNEGTCIQQDSFSSSERGSYETSKHEKQPPVYCTSPDFQMGGASDA
SAAKSPFSAVGESNLPSPSPTVSVNPLTRSSPETSSQLAPNPLLLSPTTELMEEISESLG
KNQFSSESTHLNIGHRSVGHSMNIECKGIDKELSDSKTTHIDIPRISSSLGKKPSLSSES
SIHTITPSVVNFTSLFSNKPFLKLGAVTASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSACRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPSSFVDHDFLKRRLP
KLSKSTTPSLALLTDSEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDHHRSSSDFFESEDQLQDPDDLDDSHRPTVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDAGSSRSVLESLKRYRFGKDTVGERYKHKEKHRCHMSCPHLSPSKNLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSDPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRPHRKETLPSSERAVQTLTGSQPTSEKSSQRPSESTNS
SPTRKRSLSESTSSTVNGVPSRSPRLVASGDDTVDSLLQRIVQHEDQEPLEKNIDAVIAS
ASVPPSSSPGHGHSKERILGKPDSLLVPAVPSDSCSNSMSLLSEKLPSNCSPHHIKRSVV
EAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQA
VVSMQAFQAAQFVSPELNEGEEAAALHFGPDTVTDVIEAVVQSVNLNPELKKGLKRKSWL
LEEQNKKKQKPFPEEEQENTESFTEAAVEIPSPPETPAKPPEPESTLQPVLSLIPREKKA
PRPPKKKFQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQK
RIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTR
KGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLK
AGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCD
PNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGG
KSQRMNGLTSSKSSQPVATHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTPTRLTPQ
LQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGICRDDGN
IKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDSSQQA
LAAPLLNLPPKKKNADYYEKISDPLDLVTIEKQILIGYYKTVEAFDADMLKVFRNAEKYY
GRKSPIGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDDVI
RCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHYA
QPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRIEK
LWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDLYT
YCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDFSP
HYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEMPNLEEPEQ
ERATAEVSEGEKKTEESSQDPQPACTPEERRHNQRERLNQILLNLLEKIPGKNAIDVTYL
LEEGSGRKLRRRTLFIPENSFRK
NT seq 8892 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggattttcaaga
aagagtccctctgccatcagtactggttcactggtcagcaagagagaagtagagctagaa
aacaacacaaaggaggaagaggatgttcgcaagtggaatcgagaaagaaacattgaaacg
gggaaagatgatggtttgactgatgcacagcaacagttttcagtgaaagaaacaaacttt
tcagagggaaatttaaaattgaaaattggccttcaggctaagagaactaaaaaacctcca
aagaacttggagaactatgtatgtcgacctgccataaaaacaactattaagcacccaagg
aaagcacttaaaagtgggaagatgacagatgaaaagaatgaacactgtccttcaaaacga
gatccttcaaagttgtacaagaaagcaggtgatgttgcagccattgaatgccaatctgaa
gaaagcatccatcttcattcacagggagaaaacaatcctttgtctaagaagctttctcca
gtacactcagaaatgacagattaccttaatgcaacatcatctactcttgttggtagccgg
gatcctgatttaaaggacagagcattacttaatggaggaacgagtgtaacagaaaagttg
gcacagctcattgcaacttgtcctccctccaagtcttccaagacaaaaccgaagaagtta
ggaactggcactactgcgggattggttagtaaagatttgatcaggaaagcaagcgttggc
tctgtagctggaataatacataaggacttaattaaaaaaccagctatcagcacagcagtt
ggattggtaactaaagatcctgggaaaaagccagtgtttaatgcagcagtaggattggtc
agtaaggactctgtgaaaaaactaggaactggcactacagcagtattcattaataaagac
ttaggcaaaaagccagggactatcactacagtaggactgctgagcaaggattcaggaaag
aagctaggaattggtattgttccaggtttagtgaataaggaatctggaaagaagttagga
cttggcactgttgttggactggttaataaagacttgggaaagaaactgggttctactgtt
ggcctagtggctaaggactgtgcaaagaagattgtaacaaattcaacaatgggattagtt
aataaggacattggaaagaaactagtgagttgtcctatggcaggactggtcagtaaagat
gccataaaccttaaagccgaagcactgctccccactcaggaaccacttaaggcttcttgt
agtacaaacatcaatagtcttgaaagtcaggaactgtctgaatccctgaaagacaatgcc
accagcaaaacttttgagaagaatgtcatacggcagagtaaagaaagcctattggaaaag
ttctcagttcgaaaagaaatcattaatttggagaaagaaatatttaatgaaggaacttgt
attcagcaagacagtttctcgtccagtgaaagggggtcttatgaaacctcaaagcatgaa
aagcaacctcccgtatattgcacttctccggactttcaaatgggaggtgcttctgatgca
tctgcagctaaatccccttttagtgcagtaggagaaagcaatctcccttccccatcacct
actgtgtctgttaatcctttaaccagaagttcccctgaaacttcttcacagttggctcct
aatccattacttttaagtcctaccacagaactgatggaagaaatttctgaatctcttgga
aagaaccagttttcttctgaaagtacccacttgaacattggtcataggtccgtgggtcat
agcatgaatattgaatgtaaagggattgataaagagctaagtgattcaaaaactacacat
atagatattccaagaataagctcttctctgggaaaaaagccaagtttgagttctgaatcc
agtattcatacaattaccccttcagttgttaacttcactagtttatttagtaataagccc
tttctaaaacttggtgcagtaactgcatccgacaaacactgccaagttgctgaaagccta
agcactagtttgcagtccaagccattaaaaaaaaggaaaggaagaaaacctcggtggact
aaagtggtggcaagaagtgcatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaatgtttcatgtagctcactgtcaaatagtaattctgagccagccaagttt
atgaaaaacattggaccatcttcatttgtagatcatgacttccttaaacgccgattgcca
aagctgagcaaatccacaactccatctcttgctctcttaactgatagtgaaaaaccatct
cataaatcttttgctactcacaaactatcctccagtatgtgtgtctctagtgaccttttg
tctgatatttataagcccaaaagaggaagacctaaatccaaggagatgcctcaattggaa
ggtccacctaaaaggactttaaaaatccctgcctctaaagttttttctttgcagtctaag
gaagaacaagaacccccaattttacagccagaaattgaaattccttccttcaaacaaagt
ctgtctgtgtctccttttccaaaaaagagaggcagacctaagaggcaaatgaggtctcca
gtcaagatgaagccacctgtactatcagtggctccgtttgttgccaccgaaagtccaagc
aagctggagtctgaaagtgatcaccatagaagtagcagtgatttctttgagagtgaggat
caacttcaggatccagatgatctagatgacagtcataggccaactgtctgtagtatgagt
gaccttgagatggaaccagataaaaaaattaccaagagaaacaatggacaattaatgaaa
acaattatccgcaaaataaataaaatgaagactttaaaaagaaagaaactgttgaatcag
attctttcaagctctgtagaatcaagtaataaagggaaagtgcaatctaaactccataat
acagtgtcaagtcttgccgccacatttggctctaaattgggccaacagataaatgtcagc
aagaaaggaaccatttacataggaaaaaggaggggtcgaaaaccaaaaactgtcttaaat
ggcattctttctggtagccctaccagccttgctgttcttgagcaaacagctcagcaggca
gctgggtcagcattaggacagatccttccccctttactgccttcatctgctagtagttct
gagattcttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgatgcaggctttgttgaacccagttcagtgccgtatttgcatttacactcc
agacagggcagtatgattcagactcttgcaatgaagaaggcctcaaaggggaggaggcga
ttatctcctcctactttgttgccaaattcgccttctcacttgagtgaactcacatctctg
aaagaagctactccttctcccattagtgagtctcatagtgatgagaccattcccagtgat
agtggaattggaacagataataatagcacatcagacagggcagagaaattttgtgggcaa
aaaaagaggcggcattcttttgagcatgtttctctgattccccctgaaacctctacagtc
ctaagcagtcttaaagaaaagcataaacataaatgtaagcgcagaaatcatgattacctc
agctatgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatatccacaactccga
aatagacaggatccagacttcattgcagatctggaggaattaataagtcgtctcagtgaa
attcgaattacccatcgaagtcatcattttatcccccgagaccttctgccaactattttt
cgaatcaactttaatagtttctatacacatccttctttccccttagaccctttgcactac
attcgaaaacctgacttaaaaaagaagagagggagaccccctaagatgagggaggcaatg
gctgaaatgccttttatgcatagccttagttttcctctttctagtactggattctatccg
tcttatggcatgccttactctccctcgccccttacagctgctcccataggattaggttac
tatggaaggtatcctcccactctttatccacctcctccatctccttctttcaccactcca
cttccacctccttcctatatgcatgctggtcatttacttctcaatcccacgaaataccat
aagaaaaagcataagctacttcggcaggaggcctttcttacaaccagcaggactcccctt
ctttccatgagtacctaccctagtgtccctcctgagatggcctatggttggatggtggag
cacaaacacaggcaccgtcacaaacacagagaacaccgttcttctgagcaaccccaggtt
tccatggacgctggctcttccagatccgtcctggagtctttgaagcgctatcgatttgga
aaggatactgttggagagcgatataaacataaggaaaagcaccgttgtcatatgtcttgc
cctcatctctctccttcaaaaaacttaataaacagagaagaacagtgggtccaccgagag
ccttcagagtctagtccattggccttgggattgcagacacctttacagattgactgttca
gaaagttctccaagtttatcccttggaggattcactcccaactctgatccagccagcagt
gatgaacatacaaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaac
tccagtggccggaagaaattaactgacagccctggactgttttctgcacaggacacttca
ctaaatcggcctcacagaaaggagacgctgccttccagcgaaagggcagtacagaccttg
acaggttcccaaccaacctcagagaagtcttcccagcgaccatcagagagcacaaacagt
agccccaccaggaagaggtctttatctgagagtacatcttcaacagtgaacggagttcct
tctcgaagtccaagattggttgcttctggggatgacactgtggatagtctgctgcagcgg
attgtacaacatgaggaccaagagcccctggagaaaaatattgatgctgtgattgcatct
gcgtctgtgccaccttcctccagtccaggccatggccacagcaaggagcgaatcctggga
aaaccagatagccttctagtgcctgccgtccccagtgactcttgcagtaatagcatgtca
ctcctttctgaaaagttgccaagcaactgttctccccatcatatcaagagaagtgtagtg
gaagctatgcagcgccaagctcggaaaatgtgcaattatgacaaaatcttggccaccaag
aaaaacctggaccatgtcaataagattttaaaagccaaaaaacttcaaagacaggccagg
acagggaataactttgtgaaacgcagaccaggtcgacctcggaaatgtcccctccaggct
gtggtatcaatgcaagcattccaggctgcccagtttgtcagcccagaactgaatgaaggt
gaagaagcagcagcactgcacttcggtcctgatacagttacagatgtcattgaggctgtt
gttcagagtgtaaacctgaatccagaacttaagaagggactgaagaggaaaagttggctg
ttggaagaacagaacaagaaaaagcagaagccattcccagaagaagaacaagagaatact
gaaagctttactgaagcagcagttgagattcccagtcctcctgaaaccccagccaaacct
cccgaacctgaaagtaccttgcagcctgtgctttctctcatcccaagggaaaagaaggcc
ccacgtcccccaaagaagaagtttcagaaagcagggctgtattctgacgtttacaaaact
acagacccaaagagccgtttgatccaattaaagaaagagaagctggaatacactccagga
gagcatgaatatggattattcccagcccccattcatgttggaaagtatctaaggcagaag
agaattgacttccagcttccttatgacatcctttggcagtggaaacataatcagctgtac
aaaaagccagatgttccactatataaaaaaatccgttcaaatgtctacgttgatgtcaag
cctctctctggttatgaggctacgacctgtaactgtaagaagccagatgatgataccagg
aaaggctgtgtggatgactgcctcaatagaatgatctttgctgagtgttcccccaacact
tgcccctgtggtgagcaatgctgtaaccagaggatacagaggcatgagtgggtgcaatgt
ctagaacgatttcgagctgaggaaaaaggttggggaatcagaaccaaagaacccctaaaa
gctgggcagttcatcattgaatacctaggggaggttgtcagcgaacaggagttcaggaac
agaatgattgagcagtatcataatcacagtgaccactattgtctgaacctggatagtgga
atggtgattgacagttaccgcatgggaaacgaggcccggttcatcaaccacagctgtgac
ccaaattgtgaaatgcaaaaatggtctgttaatggagtgtaccggattggactatatgct
cttaaagatatgccagctggtaccgaactcacttacgattacaactttcattcctttaat
gttgaaaaacagcaactgtgcaagtgtggctttgagaagtgtcgaggaatcattggaggc
aagagtcaacgcatgaatggactcaccagtagcaaaagcagccagcctgtggccacacac
aaaaagtctggacggtcaaaagagaagaggaagtctaagcacaagctgaagaaaaggaga
ggccatctctctgaggaacccagtgaaaacatcaacactccaacaagattgacaccccag
ttgcaaatgaagccgatgtccaatcgagagaggaactttgtattaaagcatcatgtgttc
ctggtccgaaactgggagaagattcggcagaaacaggaagaagtaaagcacaccagtgat
aatattcactcagcatcattatatacccgctggaatggcatctgccgagatgatgggaac
atcaagtctgacgtcttcatgacccagttctctgccctgcagacggctcggtctgtacga
acaagacggttggcagctgcagaggaaaacattgaagtggctcgggcagcccgcctagcc
cagatcttcaaagagatctgtgatggtatcatctcttataaagattcttcccaacaagca
ctggcagcaccacttttgaacctccccccaaagaaaaagaatgctgattattatgagaag
atctctgatcccctagatcttgtcaccatagagaagcagatcctcattggttattataag
acagtggaggcttttgatgctgatatgctcaaggtctttcggaatgctgagaagtactac
gggcgtaaatccccaattgggagagatgtttgccgcctacgaaaggcctattacaatgcc
cggcacgaggcatcagcccaaattgatgagattgtgggagagacagcaagtgaggcagac
agcagtgagacctcagtctctgagaaggagaatgggcatgagaaggacgatgatgtcatc
cgctgtatctgtggcctctacaaggatgaaggcctcatgatccagtgtgacaagtgcatg
gtgtggcaacactgtgactgtatgggagtgaattcagatgtggagcactacctttgtgag
cagtgtgatccaaggcctgtggacagagaggtacccatgatccctcggccccactatgcc
caacctggctgtgtctacttcatctgtttgctccgagatgacttgctgcttcgtcaaggt
gactgtgtgtatctgatgagggacagtcggcgcacccctgatggccacccagtccgtcag
tcctatcgactgttatctcacattaaccgagataaacttgacatcttccgcattgagaag
ctttggaagaatgaaaaagaggaacggtttgcctttggtcaccattatttccgtccccat
gaaacccaccactctccatcccgtcggttctatcacaatgaactatttcgggtgccactc
tatgagatcattcccttggaggctgtggtggggacctgttgtgtattggacctttatacg
tattgtaaagggagacccaaaggagtgaaggagcaagatgtgtacatctgtgattatcgg
cttgacaagtcagcacacctgttttacaagatccaccggaaccgctatcctgtctgcacc
aaaccctatgcctttgatcacttccccaagaagctcactcccaaaagagatttctcacct
cattatgtcccagacaactacaagaggaacggagggcgatcatcctggaagtccgagcgc
tcaaagccacccctaaaagacctgggccaggaggatgatgctctgcccttgattgaagag
gtactggccagtcaggagcaagcagccaatgagatgcccaacctggaagagccagaacag
gagagggccactgctgaagtcagtgagggtgaaaaaaaaacagaggaaagcagtcaagat
ccccaaccagcctgtacccctgaagaaagacggcataaccaacgggaacgactcaaccag
atcttgctcaatctccttgaaaaaatccctggaaaaaatgccatcgatgtgacctacttg
ctagaggaaggatcaggcaggaaactgcgaaggcgtactttgttcatcccagaaaatagc
tttcggaagtga

DBGET integrated database retrieval system