KEGG   Equus asinus (ass): 106835568Help
Entry
106835568         CDS       T04645                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
eai  Equus asinus (ass)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:eai00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    106835568
   04614 Renin-angiotensin system
    106835568
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    106835568
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    106835568
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106835568
Peptidases [BR:eai01002]
 Metallo Peptidases
  Family M2
   106835568
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106835568
CD molecules [BR:eai04090]
 Proteins
  106835568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 746 aa AA seqDB search
MGTRWTCPGPSLLVLFYYGHLLPWLRTEGDQSSDDFYNETMAKIFLQYYENTTRVVWNRF
MEASWNYVTNINQQNLEEMLLKDMERSQHMLFFGTQARLFKIARFQDPVVKRMLSKLQNI
DKAALPKDELREYNKLLAYMETMYSTAQVCMNEGPCLPLQRDIEEVMATSRDQKELLWAW
QGWRDAVGPQVRMTFERYVQLSNKAAKLNGYEDMGALWQSTYKSDTLEQDLEHLYQELQP
LYLNLHAYMRRALHRHYGPELIDLRGPIPAHLLGNMWAQSWVNILDLVLPFPKKPLDDIT
RNMKVQHWKPEKMFIEAENFYTSLGLLSTPPDFWRKSMMERLADGREVECHASAWDFYNG
QDFRIKKCTEVTIEDLFSIFHQMGHIQYFLQYKNLSVIFRAGANPAFEEAVGLVITLSVF
SHKHLLNKGLLSHQHQDSEEEVNFLMGIALDKIAFIPFAYLMDLSRWKVFDGTIQKDVYN
QEWWSTRLKYQGLCPPIPRTEEDFDPAAKFHISASMPYLRYFLSLVLQFQFHEALCKATG
HMGLLHRCDIYNSKMAGKLLEDVLKLGSSKPWPEVLEKITGETKVSAKAIMTYSKLLNWL
VTENVQQWEILGWPDFSCYFEEKETDKVTFLSLELDPNQVNFGQWVLLALSFVMFLVALL
LACRLHSLEKRSPAQDTSVQDISTLEIPPKAYFLGIAMEPRQAVKRWXLLGLCLILMLCS
IGLTIWIFTQNNRKPLWMKAEWWSWD
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaagatggacttgccctggaccttccctacttgtgctcttctattatgggcat
cttttgccatggctaaggaccgagggtgatcagagctcagatgacttctacaatgagacc
atggcaaagatcttcctgcagtattatgagaatacaaccagggttgtgtggaaccggttc
atggaggcctcctggaactatgtcaccaatatcaaccagcaaaatctggaggagatgctg
ctcaaggacatggagaggtcccagcacatgctgttctttggcacccaagcccgcctgttt
aagattgccaggttccaggacccggtcgtgaagcgtatgctgagtaagctgcagaacata
gacaaggcggccctccccaaggacgagctccgggagtacaacaagcttctggcctacatg
gagacaatgtacagcacggcccaggtgtgcatgaatgaggggccatgcctgcccctgcaa
cgtgacatcgaagaggtcatggccacctcccgggaccagaaggagctactatgggcctgg
cagggctggcgggatgctgtgggtccccaggtccgcatgaccttcgagcgctatgtgcag
ctcagcaacaaggctgcaaagctcaacggttacgaagacatgggggccttgtggcagtcc
acgtacaagtccgatacactggagcaagacctggagcatctctaccaggagctgcagccg
ctctacctcaatctgcatgcctacatgcgccgggccttgcaccgccactacgggcctgag
ctcatcgacctgagggggcccatccctgcccatcttctggggaacatgtgggctcaatcc
tgggtcaacatcttagacctggtcctgcccttcccgaagaagcccctcgatgacatcacg
aggaacatgaaagtccagcactggaagcccgagaaaatgttcatagaggctgaaaatttc
tacacgtccctggggctgctttccactccaccggatttctggagaaagtcaatgatggaa
aggctggccgatgggagggaggtggagtgccacgcctctgcctgggacttctacaatggc
caggacttcaggataaagaagtgcaccgaggtgaccatagaagacctgttctccatcttc
caccagatgggccatatccagtacttcctgcagtacaagaacctctctgtgatcttccgt
gcaggcgccaacccagcctttgaagaggccgtggggttggtgatcaccctgtcggtcttc
tcccacaaacacctgctcaacaaaggcctgctcagccaccagcaccaggactcagaggag
gaggtcaacttcctgatgggcattgccctggacaagattgccttcatccccttcgcttac
ctgatggacctgtctcgctggaaggtcttcgatggcaccatccagaaggacgtctacaac
caggagtggtggagcaccaggttgaagtaccagggcctgtgcccccccatccctcggaca
gaggaagactttgatccagctgccaagttccacatctcagccagcatgccctatctacgg
tacttcctcagcctagtgctccagtttcagttccacgaagcgctgtgcaaggccacaggc
cacatgggtctgctgcaccggtgtgacatctataactctaagatggctggaaagctcctg
gaggatgtcctaaagctgggctcgagcaagccctggccagaagtcctggagaagataact
ggggagaccaaggtgtctgcaaaggccatcatgacctactccaagctcctgaactggctg
gtcactgagaatgtgcagcagtgggagatcctgggctggccagacttcagctgttacttc
gaagaaaaagaaacagacaaggtgacattcctgagtctggagctggaccctaaccaggtc
aactttgggcagtgggtgttgctggccctgagttttgtcatgttcctggtggccctactc
ctggcctgcaggctacactccctggaaaaaaggtcaccggcccaggacaccagcgttcag
gacatcagcacacttgagataccacccaaagcctactttctgggcatagccatggagccc
cgccaggctgtcaaaagatggntcctgctgggcctctgcctcatcttgatgctgtgctca
atcggcttgaccatttggattttcacacagaacaacaggaagcctctgtggatgaaagct
gaatggtggagttgggactag

DBGET integrated database retrieval system