KEGG   Equus asinus (ass): 106840934Help
Entry
106840934         CDS       T04645                                 

Gene name
KMT5C
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
eai  Equus asinus (ass)
Pathway
eai00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106840934 (KMT5C)
Enzymes [BR:eai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106840934 (KMT5C)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106840934 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 106840934
NCBI-ProteinID: XP_014712159
LinkDB All DBs
Position
Un
AA seq 558 aa AA seqDB search
MRRRKGTPKSRLSYKWPRASTCPGFRPCFAPATLGQRQHGPWGSMGPDRVTARELCENDD
LATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRDLEAAYRALTLGGWMAH
YFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMEKNGAKIVSTRAWKKNEKLE
LLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKEVVRTC
LLCGCEDEFVPADGNAACVKVLRDIEPGDEVTCFYGDGFFGEKNEHCECYTCERCGVGEG
GGVWGPGTGNASFAQFLRSSCLPPTPRKGEGAFRLRPREPVPPRPLDKYELRETKRRLQQ
GLDSSGRQGLLGPLACAHLSPLRRDPFCAACQPLRPQPCGSRPDAVPLWLQWLPQPQLRV
RPRRRRRPQPRRALAPPVLRAARVSLHRWGGCGPRCCLRAEALVALGQVPRARWAPQQDW
HWARRYGLPYVARVDLSRMAPAPPATTVPAPVRTPGPSPGPGPIPKQALAFAPFSPPKRL
RLVVSHGSINLDVNGDRP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaggagacggaagggcacgccaaagtcccgcttgtcttataagtggcccagagcaagc
acctgcccagggttccgcccctgctttgcacccgccactctgggccagaggcagcatggt
ccgtggggcagcatggggcccgacagagtgacagccagagaactgtgtgagaacgacgac
ctggccaccagcctcgtcctggacccctacctcggcttccgcacccataagatgaatgtc
agccccgtgccccccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctg
aggcagcgggacctggaggctgcgtaccgggccctgacgctgggaggctggatggcccac
tacttccagagccggggcccacggcaggaggctgccctcaagacccacatctatcgctac
ctccgcgccttcctgcctgaaagcggctttaccatcctgccctgtacccgctattccatg
gagaaaaatggagccaagatcgtgtctacccgagcttggaagaagaatgagaagctggag
ctgctggtgggctgcatcgcggagctgcgggaggccgacgaggggctgctgagggccggc
gagaacgacttcagcatcatgtactcgacccgcaagcgcagcgcccagctgtggcttggc
cctgccgccttcatcaaccacgactgcaaacccaactgcaaggaggtggtgagaacttgc
ctcctgtgcggttgtgaagatgagtttgtgcccgcagatgggaatgcagcctgcgtgaag
gtgctccgggacatcgagccaggggacgaggtgacctgcttctacggtgacggcttcttt
ggtgaaaagaatgagcactgtgaatgctacacctgcgagaggtgtggggtgggagaggga
ggaggggtctggggtcccggaaccggaaatgcctcctttgcccaattccttcgttcctcc
tgtctccctcccacccccaggaaaggcgaaggagctttccgactgcggccccgggagcct
gtgcctccacgacccctggacaagtacgagctccgggagaccaagcggcggctgcagcaa
ggcctggacagcagtggccggcagggcctactgggcccactcgcctgcgcccacctgtct
ccgctgcgccgggaccccttctgcgccgcctgtcagcccctgcgcccccagccctgcggc
tcccgcccggacgccgtgcccctctggctccagtggctgcctcagccacagctccgagtg
cgcccccggaggcgccgacgcccccagcccaggcgggccctggcaccccctgttctccgc
gctgcccgtgtctccctgcaccggtggggaggctgcggcccccgctgttgcctccgggca
gaagccctggtggccctgggccaagtcccccgtgcccgttgggccccccagcaggactgg
cactgggcccggcgctacgggctgccttatgtggcgcgcgtggacctgagccgcatggcc
ccagccccacctgccactactgtccccgcccctgtcaggaccccaggccccagccccggc
cccggccccatccccaagcaagcccttgccttcgctcccttctccccacccaagcgcctg
cggctggtggtcagccacggctccatcaacctggatgtcaatggtgacaggccatga

DBGET integrated database retrieval system