KEGG   Equus asinus (ass): 106842002Help
Entry
106842002         CDS       T04645                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00590  Arachidonic acid metabolism
eai01100  Metabolic pathways
eai04611  Platelet activation
eai04726  Serotonergic synapse
eai04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    106842002 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    106842002 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    106842002 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    106842002 (PTGS1)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106842002 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 106842002
NCBI-ProteinID: XP_014713802
LinkDB All DBs
Position
Un
AA seq 599 aa AA seqDB search
MSRQSLWLRFPLLLLLLPSLVLPADPRAPALVNPCCYYPCQHKGICVRFGLDRYQCDCTR
TGYSGPNCTIPELWTWLRNSLRPSPSFLHFLLTHGRWFWEFVNATFIRDMLMRLVLTVRS
NLIPSPPTYNVAHDYVSWESFSNVSYYTRVLPSVPQDCPTPMGTKGKKQLPDAQLLSDRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YHLRLFKDGKLKYQMLNGEMYPPTVEQAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKTEHPTWDDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVHFQYRNRIAMEFNHLYHWHPLMPDSFRVGSQEYSYKQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNLDHHVLHVAVDVIKESRELRLQPFNEYRKRFGMKPYASFQEL
TGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTNACPYVSFRVPKRPQDDGPGVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtctctggctccggttcccgctgctcctgctgctgctaccgtcccta
gtcctgcccgcggaccccagggcgccggcgctagtgaacccctgttgttactacccatgc
cagcacaagggtatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctactccggccccaactgcaccatccctgagctatggacctggctccggaattca
ttgcggcccagcccctccttcctccacttcctgctgacacatgggcgctggttctgggaa
tttgtcaacgccaccttcatccgtgacatgctcatgcgcctagtactcacagtgcgttcc
aaccttatccccagcccccccacctacaacgtagcacatgactacgtcagctgggagtcc
ttctccaatgtgagttattacactcgtgtgctgccctctgtgccccaagactgtcccacg
cccatggggaccaaagggaagaagcagctgccagatgcccagctcctgagcgatcgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggaacgtcag
tatcacctgcggctctttaaggatgggaaactcaagtaccagatgctgaatggagagatg
tacccgccaacggtggaacaggcgcctgtgttgatgcactacccacggggtattccaccc
cagagccagatggccgtgggccaggaggtgtttgggctgcttcctgggctcatgctctat
gctacgctctggctacgcgagcacaaccgtgtgtgtgacctactgaagactgagcacccc
acctgggatgatgagcagctcttccagacggcccgcctcatcctcatcggggagaccatc
aagatcgtgattgaggagtacgtgcagcagctgagcggctacttcctgcagctgaagttt
gacccggagctgctcttcggcgtccacttccagtatcgcaaccgcattgccatggagttc
aaccacctctaccactggcacccactcatgcctgactccttcagggtgggctcccaggag
tacagctataagcagttcctgttcaacacctccatgctggtggactacggggtcgaggcc
ctggttgatgccttttctcgccagatcgctggccggatcggtggaggtaggaacctggac
caccatgtcctgcacgtggctgttgacgtcatcaaggaatcccgagagctgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaagccctacgcctctttccaggagctc
actggagagaaggagatggcagctgagttggaggagctgtatggagacatcgatgccttg
gagttctaccctgggctgcttcttgagaagtgccatccaaactccatctttggggagagt
atgatagaaattggagctcccttctccctcaagggcctcctaggcaatcccatctgttct
ccggagtactggaaaccgagtacatttggtggtgaaatgggcttcaacattgtcaagacg
gctacgctgaagaagctggtctgcctcaacaccaacgcttgtccctatgtttccttccgt
gttcccaagcgcccccaggatgatgggcctggtgtggagcggccttccacagagctctga

DBGET integrated database retrieval system