KEGG   Equus asinus (ass): 106843408Help
Entry
106843408         CDS       T04645                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
eai  Equus asinus (ass)
Pathway
eai00601  Glycosphingolipid biosynthesis - lacto and neolacto series
eai01100  Metabolic pathways
Module
eai_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106843408 (B3GALT1)
Enzymes [BR:eai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     106843408 (B3GALT1)
Glycosyltransferases [BR:eai01003]
 Glycan extension
  Type 1 chain
   106843408 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 106843408
NCBI-ProteinID: XP_014715909
LinkDB All DBs
Position
Un
AA seq 326 aa AA seqDB search
MASKVSCLYVLTVVCWASALWYLSVTRPTSSYTGTKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNVPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcctgtttgtatgttttgacagttgtgtgctgggccagcgctctc
tggtacttgagtgtaactcgtccgacttcctcctacactggcaccaagccattcagccac
ctaacagttgccaggaaaaacttcacgtttggcaatataagaactcgacctataaaccca
cattcttttgaatttctcataaatgaacccaacaagtgtgagaaaaatgttccttttctt
gttatcctcatcagcaccacccacaaagaattcgatgcccgccaggcaatccgagagacc
tggggggatgagaacaacttcaaagggatcaagatagccaccctcttcctcctgggcaag
aatgctgatcctgtcctcaatcagatggtggagcaagagagccaaatcttccacgatatt
atcgtggaggacttcattgactcctaccataaccttaccctcaaaacattaatggggatg
agatgggtggccactttttgttcaaaagccaaatatgtcatgaaaacagacagtgacatt
tttgtaaacatggacaaccttatttataaactactaaaaccctccaccaagccaagaaga
aggtattttactggctatgtcatcaatggagggccaatccgggacgtccgcagtaaatgg
tatatgcccagggatttgtaccctgacagtaactacccaccattctgttcagggactggc
tatatcttttcagctgatgtggctgaactcatttacaagacctcactccacacaaggctg
cttcaccttgaagatgtgtatgtgggactgtgtcttcgaaaactgggcatacaccctttc
cagaacagtggcttcaatcactggaaaatggcctacagtttgtgtaggtatcgccgagtt
atcaccgtgcatcagatctctccagaagaaatgcacagaatctggaatgacatgtcaagc
aagaaacatctcagatgttag

DBGET integrated database retrieval system