KEGG   Equus asinus (ass): 106844276Help
Entry
106844276         CDS       T04645                                 

Gene name
KMT5B
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
eai  Equus asinus (ass)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106844276 (KMT5B)
Enzymes [BR:eai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106844276 (KMT5B)
Chromosome [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106844276 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 883 aa AA seqDB search
MKWLGEAKNMVVNGRRNGGKLSNDHQQTQPKVQHTGKDTVKAGRAAGERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKTQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSTRKSSIGVKKNSKGRALTRPPAPRTPA
SAHSTSSKLTHVSNSRVPKKLKKPAKPLPSKIKLRNHCKRLEQKSASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPVQANVAGGCLTRHAAREHKQNSGRGAPSHGEGAPCTYTPRR
SMRTKTNLKTSDIKLEPNTLDGYKDSSTEPCPDSGEQPTPAVQEEELAHETAQNGEAKCH
KTDNSMSKKKSRQGKLVKQSAKAEESTPVHDSPGKAGVALDVMGSHSDQGEHSGPEGLPG
SYTDWAPSPGGGSVVTSDSFKAKDNFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRR
HDSSSKANDQESDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKR
DEEGRGSYVEGLHENGVCCSDPLSLLESQMEVGDYSQYEEESTDGPSSSEGDEEDDDDDD
DDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaagccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagactcaacccaaagtacagcacacgggaaaggacacggtg
aaggctggcagagccgcgggcgagcggaggtcgagccgatgtaatggtaattcaggattt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagttttcct
cacaacaaccctgtgaggtttcggcctattaaaggaaggcaagaagaactgaaggaagta
attgaacgttttaagaaagatgagcacttggagaaagccttcaaatgtttgacctcaggc
gaatgggcgcgtcactattttctcaacaagaacaaaacgcaggagaagctgttcaaggaa
catgtatttatttacttgcgaatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctgcttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgcggcgtttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatacggcatgtgtgaaggctcttagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatacggactcagagaaacagacaaacgcttaaatagg
cttaaaaagttaggggacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctacccgaaaatcttccattggt
gtgaagaagaacagcaagggcagagcattgacaaggccgcctgcgccaaggactccagct
tctgcccactctacctcatccaagctaactcacgtcagtaactccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttaccttcaaagataaaactacgaaatcactgcaaacgg
ctggagcaaaagagcgcttcgagaaaactcgaaatgggaaacttggtacttaaagagcct
aaagtagttctgtataaaaatttgcccattaaaaaagataaggagcccgagggaccagtc
caggccaacgtggctggtgggtgcttaacgagacacgcagcaagagagcacaaacagaac
tctggccgaggtgctccttcacatggggagggcgctccctgcacatacacccccaggcgg
tcgatgaggacgaaaacgaatctgaagacctctgatatcaagcttgaaccaaatacgttg
gacggctataaggacagctcgacggagccttgccctgacagtggcgagcagccgactcct
gcagtgcaggaagaagaactggctcacgaaactgcacaaaatggggaagcaaagtgtcat
aagactgacaacagcatgtcgaaaaagaaatcgcgacaagggaaacttgtgaaacagtcg
gcaaaagcagaggaatccactccggtgcatgattcccctggaaaagcgggtgtggcgctg
gatgtgatggggtcccactctgaccagggcgagcacagcggcccagagggcctgcctggg
agctacacggactgggccccttcgcctgggggcggttcggttgtgacatcagatagcttc
aaagcaaaagacaacttcagaactgcaaaaagtaaaaagaagaggcgaatcacaaggtat
gatgcacagttaatcctggagaataactctgggattcccaaattgactcttcgcaggcgt
catgatagcagcagcaaggcaaatgaccaagagagtgatggaatgaattcttcaaaaata
agcatcaagttaagtaaagaccatgaaaatgataataatctctatgtagcaaagcttaac
aatggatttaactcaggatcgggcagtagttctacgaagctaaaaatccagctcaaacgg
gacgaggaaggtagggggtcctatgtggaggggcttcatgaaaacggggtgtgctgtagt
gaccccctttctctcctggagtctcagatggaagtcggcgactacagtcagtatgaggag
gagagcaccgacggcccctcctcttcggagggcgacgaagaggacgacgacgacgacgac
gacgactttgaagatgacttcattcctcttcctcccgcaaagcgattgaggctgatagtt
gggaaggactccatagacattgacatttcctccaggaggagagaggatcagtctctgagg
cttaacgcgtaa

DBGET integrated database retrieval system