KEGG   Enterobacter aerogenes EA1509E: CCG28920Help
Entry
CCG28920          CDS       T02447                                 

Definition
(GenBank) Probable glutathione S-transferase (EC 2.5.1.18), YfcG homolog
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ear  Enterobacter aerogenes EA1509E
Brite
Enzymes [BR:ear01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CCG28920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(113203..113832)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAQLAYRLIRVDIGKGEQFRPQFLAISPNNKIPAIVDHVP
VDGGAPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
HAPQAVPYAIERYQVESQRLYGVMNRRLEASPWLGGEHYSIADIACWPWINAHSRQRIDL
SQFPAVHNWFERIRQRPATQQALLKTQQY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactacgcacctacccccaacggccacaaaatcactctttttctcgaa
gaggcgcagctggcctatcgcctgatacgcgtcgatatcggcaaaggtgaacagtttcgc
ccgcagtttctggctatctcgccaaataataagatcccggcgatcgttgaccacgttccg
gtcgacggcggcgcgccgttaagcctgtttgagtcaggagagatcctgctctatctggcg
gagaaatcgggaaaattactaagcggcgagctgcgcgagcggcatactaccctgcaatgg
ctattctggcaggtcggcggtctggggccaatgcttgggcaaaaccaccactttaaccat
cacgcgcctcaggctgtcccttacgccattgaacgctatcaggtcgaaagccagcgcctg
tatggcgtaatgaaccggcgtcttgaagccagtccatggttgggcggcgagcactacagt
atcgccgatatcgcctgctggccatggattaatgcccactcgcgccaacgcatcgatctt
agccagttcccggcggtgcataactggtttgaacgcatccgccagcgcccggcaacgcaa
caggcgctactcaaaacgcaacagtattaa

DBGET integrated database retrieval system