KEGG   Enterobacter asburiae LF7a: Entas_2977Help
Entry
Entas_2977        CDS       T01604                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00564  Glycerophospholipid metabolism
eas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Entas_2977
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Entas_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 NAD_binding_8 3HCDH_N Thi4 HI0933_like Pyr_redox Pyr_redox_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AEN65702
UniProt: G2S185
LinkDB All DBs
Position
3198465..3200093
Genome map
AA seq 542 aa AA seqDB search
MTIHDPRYSDVIIIGGGATGAGIARDCALRGLNVTLLERHDIATGATGRNHGLLHSGARY
AVTDGESARECIAENQILKRIARHCIEPTDGLFITLPEDDLAFQHTFITACTAAGIHAEA
IDPALARRIEPSVNPALMGAVKVPDGTVDPFRLTAANMLDAREHGARILTGHEVTGLIRK
GDTVCGVRVFDPQYNEYSDLYAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSTHVDYSEIDYNRVTAEEVDILLREGEKLAP
VMAHTRILRAYAGVRPLVASDNDPSGRNVSRGIVLLDHAERDGMEGFITITGGKLMTYRL
MAQWATDAVCRKLGNTEPCVTADKPLPGSQQSTEKTLQKIISLPAPLRGSAVYRHGDRTP
AWLGEGRLSRSLVCECEAVTAGEVQYAVENLTVNNLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFHATTSTQSLAQLSDFLNERWKGIQPVAWGDALRESEFTRWVYQGLCGLEKEQHD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcacgatccccgttatagcgatgtgattatcattggcggtggggcaaccggt
gccggtatcgcacgcgactgtgccctgcgagggttaaacgtcacgctgctggagcgccac
gatatcgccaccggcgcaaccgggcgtaatcatggtttgctgcacagcggcgcacgttat
gccgtcacagacggtgaatccgcacgcgagtgtattgccgaaaaccagatcctcaaacgc
atcgcccgtcattgtattgaaccgaccgatggtcttttcatcacccttcccgaagatgat
ctcgcgttccagcacacctttattacggcctgtaccgccgcgggtattcacgccgaagcg
atagatcccgcgctggcgcgtcgtattgagccttctgtaaacccggcgctgatgggcgcc
gttaaagtccctgacggcaccgttgacccgtttcgtctcacggccgccaatatgctggat
gcccgtgagcatggcgcccgcatcctgaccgggcatgaagtcaccgggcttatccgcaag
ggagataccgtgtgcggcgtgcgggtgtttgacccgcaatataatgaatacagcgatctg
tatgcccccgtggtggtcaatgcggcggggatctgggggcagcgcattgcagaatacgcc
gacttatccatccgcatgttcccggcaaaaggctcgctgctgatcctcgatcaccgcatc
aataaccatgtcattaaccgctgccgtaaaccgtctgacgccgatatcctggtgccgggc
gacactatctcgttgattggcaccacttcaacccacgttgactacagtgaaattgattac
aaccgggtgaccgccgaagaggtcgatattctgctgcgcgaaggggaaaaactggctccg
gtgatggctcatacccgaattcttcgggcttatgcgggtgtacgcccgctggttgccagc
gataacgatcccagcggacgtaacgtcagccgtggcattgtgttgctcgatcacgcagag
cgcgacggcatggaagggtttatcactatcaccggcggtaaattgatgacctaccgtctg
atggcacagtgggccacagacgccgtgtgtcgcaaactgggcaataccgaaccctgcgta
accgcagataagcccctccccggatcacagcaatccacggaaaaaacgctgcaaaaaatc
atctcactgcccgcgccgctgcgtggttctgcggtctatcgccacggtgaccgcacacca
gcatggctcggtgagggacgtcttagccgaagcctggtgtgcgagtgcgaggccgtaacc
gcaggtgaagtgcagtacgccgttgaaaatctgacggtgaataacctgctcgatttacgc
cgccgcacgcgcgtcggcatggggacctgtcagggcgagctgtgcgcctgccgcgcggcc
gggctgctgcaacgttttcacgccaccacctcaacccagtcgcttgctcagctcagcgat
tttttaaacgaacgctggaaaggcattcagcctgttgcctggggcgatgccctgcgcgaa
agcgaattcacccgctgggtctaccaggggctttgcggtctggagaaggaacaacacgat
gaaatttga

DBGET integrated database retrieval system