KEGG   Enterobacter asburiae LF7a: Entas_3023Help
Entry
Entas_3023        CDS       T01604                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
eas  Enterobacter asburiae LF7a
Brite
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Entas_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 NADH_u_ox_C
Motif
Other DBs
NCBI-ProteinID: AEN65748
UniProt: G2S267
LinkDB All DBs
Position
3248710..3249339
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTANGHKVTLFLEEAKLDYRIIRVDISKGDQFRPDFLAISPNNKIPAIVDNAP
ADGGRPFSLFESGEILLYLAEKTGKLLSGELRERHHTLQWLFWQSSGLGPMLGQNHHFNA
FAPQLIPYAIERYQVETQRLYGVMNRRLEKSPWLGGDHYSIADIACWPWINTHERHRIDL
ATYPAVNNWFERIRTRPATERALQKAQQI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctctactatgcccctaccgcgaatggtcataaggtcaccctctttctggaa
gaagcaaaactggattaccggatcatccgcgtcgatatcagcaagggcgaccagttcaga
ccggattttctggccatctcacccaataacaaaattcctgccatcgttgataatgcgcca
gcggacggcggcagaccgtttagcctgtttgaatcaggcgagatactgctgtatctggca
gagaaaaccggcaagctgctcagcggtgaattgcgtgaacgccaccacacactgcaatgg
ttgttctggcaatcgagcgggctcgggcccatgctggggcaaaatcaccattttaatgct
ttcgcgccgcagctcatcccctacgcgatagagcgctatcaggttgagactcaaagactt
tatggcgtgatgaaccgtcggctggaaaaatcaccctggctcggtggcgatcattacagt
attgccgacattgcctgttggccgtggataaatacccacgaacggcaccggattgactta
gccacttacccggcagtgaataactggttcgagcgcatccgcacgcgcccggccaccgag
cgcgccctgcaaaaagcgcagcagatttaa

DBGET integrated database retrieval system