KEGG   Aromatoleum aromaticum: ebA1105Help
Entry
ebA1105           CDS       T00222                                 

Gene name
pykA
Definition
(GenBank) Pyruvate kinase II protein
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ebA1105 (pykA)
   01230 Biosynthesis of amino acids
    ebA1105 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA1105 (pykA)
   00620 Pyruvate metabolism
    ebA1105 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    ebA1105 (pykA)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     ebA1105 (pykA)
Exosome [BR:eba04147]
 Exosomal proteins
  Proteins found in most exosomes
   ebA1105 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
642149..643597
Genome map
AA seq 482 aa AA seqDB search
MPRHTKIVATLGPASSDPQVLERMVHAGVDVVRMNFSHGKAEDHVARAEAIREAASLAGR
PVGILADLQGPKIRVGKFAEGQVELQRDAGFILDARCELGNAERVGLDYKDLPKDVKAGD
VLLLDDGRLKLTVTRVIGHEIHTVVKVGGTLSNNKGINRQGGGLTAPALTAKDMDDIKTA
AKIGVDFVAVSFPKSAADMYMARQLMRASGVDALLIAKIERTEAVANLDEILDASDGIMV
ARGDLAVEVGDAAVPALQKKMIRAARDRNKLTITATQMMESMITSPVPTRAEVSDVANAV
LDGTDAVMLSAETASGRFPVEVVEAMSRVCLEAEKSSDVALDRDVLNRVFTRIDQSIAMA
AIWTAWHLKVKAIASLTQTGSTALWMSRLNSGVPIYALTPEASARNQMTLYREVFPLLMS
QTHQDRDVLLWEAEQILIDQGVAERGDLIVLTIGEPIGASGGTNTLKIVRVGEHPPPHVT
DQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccacgccacaccaagatcgtcgccactctcggccccgcctcgtccgacccgcaggtg
cttgaacgcatggttcacgccggcgtcgacgtggtgcggatgaatttctcgcacggcaag
gcggaggatcacgtcgcgcgggccgaggcgatccgcgaagcggcatcgctggcgggccgg
ccggtcggcattctcgccgacctgcagggacccaagatccgtgtcggcaagttcgccgaa
gggcaggtcgaactgcagcgcgatgccggattcatcctcgatgcgcgctgcgagctgggc
aacgccgagcgggtcgggctcgactacaaggacctgccgaaggacgtcaaggccggcgac
gtgctgctgctcgacgacggacggctgaagctgacggtcacgcgcgtcatcggccacgag
atccacaccgtcgtcaaggtcggcggcacgctgtcgaacaacaagggcatcaaccgccag
ggcggcggcctgactgcgcccgcactgaccgcgaaggacatggacgacatcaagacggcg
gcgaagatcggcgtcgatttcgtcgcggtgtcgttcccgaaaagcgcagccgacatgtac
atggcgcgccagctgatgcgcgcgtcgggagtcgatgcgctgctgatcgcgaagatcgag
cgcaccgaagcggtcgcgaacctcgacgagatcctcgatgcatccgacggcatcatggtc
gcgcgcggcgatctcgcggtcgaagtgggggacgccgcagtgccggcgctgcagaagaag
atgatccgtgcggcacgggaccgcaacaagctgacgatcaccgcgacgcagatgatggag
tcgatgatcacgagtccggtgccgacgcgcgccgaagtctccgacgtcgccaacgcggtg
ctcgacggcaccgacgcggtgatgctgtcggccgaaaccgcgtccggcaggttccccgtc
gaagtcgtcgaagcgatgagccgcgtgtgcctcgaagccgagaagtcgtccgacgtggcg
ctcgaccgcgacgtgctgaaccgcgtcttcacgcgcatcgaccagtcgatcgcgatggcg
gcgatctggacggcgtggcatctcaaggtcaaggcgatcgcgtcgctgacgcagaccggc
tcgaccgcactatggatgagccgcctcaacagcggagtgccgatctacgcgctcactccc
gaagcgagcgcgcgcaaccagatgacgctgtatcgcgaagtgttcccgctgctgatgtcg
cagacgcatcaggatcgcgacgtgctgctgtgggaggccgagcagatcctgatcgaccag
ggcgtcgccgagcgcggcgacctgatcgtgctgacgatcggcgagccgatcggcgcatcc
ggcggcaccaacacgctgaagatcgtccgcgtcggcgaacatccgccgccgcacgtcacc
gaccagtaa

DBGET integrated database retrieval system