KEGG   Aromatoleum aromaticum: ebA4463Help
Entry
ebA4463           CDS       T00222                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ebA4463
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ebA4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2647422..2649050
Genome map
AA seq 542 aa AA seqDB search
MSAGGEEGSVQETSLHAHARSAAAERRLARTVLLDRLRKSQRWDVVVIGGGATGLGCAVD
AAARGYSTLLVEACDFAKGTSSRATKLIHGGVRYLARGELGLVREALAERSRLLANAPHL
VHPLRFVVPAYHWHDRARFGLGLGFYDLLAGIHGIERSRMLDAAATAAALPGLNPSGLRG
GIAYWDAQFDDARLAIALMRTVFDLGGLALNYLPVDGLILEAGRVQGVIARDAESGEVFR
IAARVVINATGVWADAVRRLERPAASALVRPSQGVHVVVDRSFLPGDTALLVPETPDGRV
LFVIPWQGKVLIGTTDTPRSDVPLEPEALPGEVDFILATAARYLAPAPTRADVRSIFVGL
RPLVGEDDRTATHRLSREHCIEVSPGGLVTITGGKWTTYRRMAEETVDQACALGMLPRRP
AATAALRLHGATTGFSGDCYGCDRAVVDLLPGAARRIQDGLTLTEAEVRHAARFELARGV
EDVLARRHRALVLDAARAAAAAPAVAALLAQELGHDAQWCVDEVARFRALAIRYGAPAGE
CS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgggcggcgaggaggggagcgtccaggaaaccagtcttcatgcgcacgcccga
tccgctgcggcggagcgccgacttgcccgcacggtgctgctcgatcgcctgcgcaagtcg
cagcgctgggacgtggtcgtcattggcgggggtgcgaccgggctcggatgcgcggtcgat
gccgccgcacgcggctattcgacgctgctcgtcgaagcatgcgacttcgcgaaaggaacc
agttcgcgggcgacgaagctgattcacggcggcgtgcgttatctcgcacggggcgagctg
gggctggtgcgcgaagcgctcgccgagcgttcgcggctgctcgcgaacgcgcctcacctc
gttcatccgctgcgtttcgtcgtgccggcctatcactggcacgaccgggcgcgattcggg
ctggggctcgggttttacgatctgcttgccggcatccacggcatcgagcgcagccgcatg
ctcgacgcggccgcgacggccgcagcgctgccgggcttgaatccctccgggctgaggggc
gggatcgcctactgggacgcccagttcgacgacgcgcggctggcaatcgcgctgatgcgc
acggtcttcgacctgggcggcctggcactcaactacctgccggtcgacggtctgatcctc
gaagccggccgcgtgcaaggggtcatcgcgcgtgatgcggaaagcggcgaggttttccgc
atcgctgcccgcgtcgtcatcaacgcgaccggtgtatgggccgacgcggtgcggcgtctg
gaacgtcccgcggccagcgcgctggtgcgtccgagccagggcgtgcacgtcgtcgtcgac
cggagtttcctcccgggcgataccgcgctgctggtgccggagacgccggatggacgcgtg
ctgttcgtcattccgtggcaaggcaaggtcctgattgggacgaccgatacgcctcgctcc
gacgttccgctggagcccgaagcgctgcccggtgaagtggatttcatcctcgcgaccgcg
gcccgctatctcgcgccggccccgacacgggccgatgtgcgcagcatcttcgtcggcctg
cggccgctggtcggtgaggacgacaggacggcgacgcaccggctgtcgcgcgaacattgc
atcgaagtgtcgcccggcgggttggtgacgatcaccggcggaaaatggacgacgtaccgg
cgaatggcagaggaaaccgtcgaccaggcctgcgccctcggcatgctgccgcgacgcccg
gcagcgaccgccgcgctgcgcctgcacggcgcgaccaccggtttttccggcgactgctat
ggctgcgaccgcgccgtcgtcgacctgctgccgggtgccgcccggcgcatacaggacggc
ctgacgctgaccgaggccgaagtacgccatgccgcacggttcgagcttgcacgtggcgtc
gaggacgtgctggcgcgccggcaccgcgcgctggttctcgatgccgcacgggctgccgcg
gcagcaccggcggtcgcggcgctgctcgcccaggaactcggacacgatgcgcagtggtgc
gtggacgaagtcgcgcgctttcgcgcgctggcgatccgctatggtgcgccggccggagaa
tgctcgtga

DBGET integrated database retrieval system