KEGG   Escherichia coli BL21(DE3): B21_02801Help
Entry
B21_02801         CDS       T02096                                 

Gene name
ybl132
Definition
(GenBank) ybl132
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ebe  Escherichia coli BL21(DE3)
Brite
Enzymes [BR:ebe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     B21_02801 (ybl132)
Lipid biosynthesis proteins [BR:ebe01004]
 Acyl-CoA synthetase
  Unknown
   B21_02801 (ybl132)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2990795..2992516
Genome map
AA seq 573 aa AA seqDB search
MSNKIFTHSLPMRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQTLKARAEAGA
KRLLSLNLKKGDRVALIAETSSEFVEAFFACQYAGLVAVPLAIPMGVGQRDSWSAKLQGL
LASCQPAAIITGDEWLPLVNAATHDNPELHVLSHAWFKALSEADVALQRPVPNDIAYLQY
TSGSTRFPRGVIITHREVMANLRAISHDGIKLRPGDRCASWLPFYHDMGLVGFLLTPVAT
QLSVDYLRTQDFAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDLAELDLSCWRV
AGIGAEPISAEQLHQFAECFRQVNFDNKTFMPCYGLAENALAVSFSDEASGVVVNEVDRD
ILEYQGKAVAPGAETRAVSTFVNCGKALPEHGIEIRNEAGMPVAERVVGHICISGPSLMS
GYFGDQVSQDEIAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWPQDIEYIAEQE
PEIHSGDAIAFVTAQEKIILQIQCRISDEERRGQLIHALAARIQSEFGVTAAIALLPPHS
IPRTSSGKPARAEAKKRYQKAYAASLNVQESLA
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataaaatctttacgcattccctacctatgcgctatgccgattttccaacgctt
gttgatgctttggactacgccgctctgagtagcgccggaatgaatttttatgacagacgt
tgccaacttgaagatcaactggaatatcagacgttaaaagcacgtgccgaagctggtgcg
aagcggttgttatcgctgaacctgaaaaaaggcgatcgcgtggcactgattgccgaaaca
agtagcgagttcgtagaggctttttttgcctgccagtatgccggcttagtcgccgtcccg
ttggcgattccaatgggcgttggtcagcgggattcctggagcgccaaattgcagggttta
ctggcaagttgccagcccgcagccattatcactggtgatgagtggttgccactggtcaat
gccgcgacgcatgacaaccccgaattacatgttttaagccacgcttggtttaaggcatta
tcggaagccgatgttgcgctccagcgtccagttccgaacgatatcgcctacctccagtac
acctccggcagcacccgttttccccgtggcgtcattatcacccatcgcgaagtgatggct
aatctacgtgctataagccacgacggcattaaattacgccctggcgaccgctgcgcctcc
tggctgcctttctaccatgatatgggactggtcggctttctcctgacccccgtcgccacg
cagctttcagtagattatttgcgcactcaggattttgccatgcgtcctctgcaatggctt
aaattgatcagtaaaaatcgcggcaccgtttccgttgcgccgccgtttggctatgaattg
tgccagcgccgcgtgaatgaaaaagatctcgctgaactggatctttcctgctggcgcgtc
gctggtattggtgcagaacccatctccgcagaacaactccatcaattcgctgaatgtttc
cgtcaggttaactttgacaataaaactttcatgccgtgctacggactggcagaaaatgcg
ctggctgtcagcttctctgatgaagcctccggggttgtggttaacgaagtggatcgcgac
atcctcgaatatcagggtaaagccgtcgcgccgggtgcagagacacgcgccgtatcgact
ttcgtcaactgcggcaaagcgttgccggaacatggtattgaaatccgcaatgaagcaggt
atgccggtcgcggaacgtgtggtaggccatatttgcatctccggtcccagtctgatgagc
ggttactttggcgaccaggtttcgcaagacgagattgccgcgacgggctggttagacacc
ggcgacctcggttatctgctggacggttatctgtatgtcaccggacgcattaaagatctg
attattattcgtggccgtaatatctggccgcaggatattgaatatatagcggaacaggaa
ccggaaattcattctggcgatgcgattgcttttgttaccgcccaggaaaaaatcattttg
cagatccagtgtcggatcagcgacgaagaacgtcgcgggcagcttatccacgcgctggcg
gcacggatccaaagcgaatttggcgtgaccgcggctatcgctctgttgccgccccacagt
attccccgaacgtcctccggcaagcctgcccgtgcggaagcgaaaaaacgttatcagaag
gcttatgctgccagtcttaatgtgcaggaatccctggcatga

DBGET integrated database retrieval system