KEGG   Enterobacteriaceae bacterium FGI 57: D782_1370Help
Entry
D782_1370         CDS       T02431                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ebf  Enterobacteriaceae bacterium FGI 57
Brite
Enzymes [BR:ebf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     D782_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGB77383
UniProt: L0M0G8
LinkDB All DBs
Position
complement(1411524..1412153)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEVELPYRLIRVDINKGEQFKPQFLDISPNNKIPAIVDHQP
EDGGAPFSLFESGAILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQPVPYAIERYQVETQRLYSVLNQRLASHPWIAGDHYSIADIACWPWVNSHQRQRIDL
ATYPAVQNWFERIRQRPATARAMQQAQPH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctttactatgcgcccaccccgaacggccacaaaattacccttttccttgaa
gaggtagagctgccctaccgtttgattcgcgtcgatatcaataaaggcgagcagtttaag
ccgcaatttctcgatatttcaccgaataacaaaatcccggccattgtggatcatcaaccg
gaggatggcggtgcgccgttcagcctgtttgaatccggggccatcctcctctatctggca
gaaaaatccggtaaattgctgagcggcgaactgcgcgagcgccatacgacgttacagtgg
ttgttctggcaggtcggcggtcttggcccgatgctggggcaaaaccaccattttaatcac
ttcgccccgcagcccgttccctacgccattgagcgataccaggtggaaacccagcgcctg
tatagcgtgctgaatcaacgccttgccagtcacccgtggatagcgggcgatcactacagc
attgccgatatcgcctgctggccgtgggtaaattcccaccagcggcaacgtatcgatctt
gccacctatccggcggtgcaaaactggtttgagcgcatccgccagcgcccggcaaccgcg
cgtgccatgcagcaggcgcagccccattaa

DBGET integrated database retrieval system