KEGG   Erwinia billingiae: EbC_30930Help
Entry
EbC_30930         CDS       T01270                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ebi  Erwinia billingiae
Pathway
ebi00250  Alanine, aspartate and glutamate metabolism
ebi00410  beta-Alanine metabolism
ebi00640  Propanoate metabolism
ebi00650  Butanoate metabolism
ebi01100  Metabolic pathways
ebi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EbC_30930 (goaG)
   00650 Butanoate metabolism
    EbC_30930 (goaG)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EbC_30930 (goaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EbC_30930 (goaG)
Enzymes [BR:ebi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EbC_30930 (goaG)
Amino acid related enzymes [BR:ebi01007]
 Aminotransferase (transaminase)
  Class III
   EbC_30930 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAX60624
UniProt: D8MUW7
LinkDB All DBs
Position
3472583..3473842
Genome map
AA seq 419 aa AA seqDB search
MNSEVQQRRLAATPRGVGVMCDFYAVRAENATLWDHQGREYTDFTAGIAVLNTGHRHPKV
VEAVRNQLDCFTHTAFQVIPYENYLLLAERLNQRVPIAGPAKTTFFSSGAEAVENAVKIA
RAATGRPGVIAFTGAFHGRTMMTMGLTGKVVPYKTGFGPFPGSVFHARYPNALHGHSIDD
AMESLESLFRCDISPQQVAAIIFEPIQGEGGFNIAPVEFVSKLRTLCDQHGILLIADEIQ
TGFARTGKLFACEYYPDAKPDLITMAKSLGGGLPISAVSGRAEVMDAPLPGGLGGTYAGN
PLAIASSLAVLEVIDEEALCDRALRLGAELVETLNGCGNPALVEVRARGSMVAAEFNDPA
TGKPSAEIAKNIQQKALEHGLILLTCGVHGNVIRFLYPLTIPDAQFKQALTLLDTLLRA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgaagtgcaacagcgtcgtttagctgccacgccgcgcggcgttggcgtgatg
tgtgatttctacgccgttcgcgcagaaaacgccacgctgtgggatcatcagggacgagag
tataccgattttaccgccgggatcgccgttctgaataccggacaccgtcatccaaaagtg
gttgaagcggttcgcaaccagctggactgcttcacgcataccgcttttcaggtcattccc
tacgagaattatttgctgctggccgagcgcctgaatcagcgggtgccgattgccggcccg
gcaaaaaccacttttttctccagcggcgcggaagcggttgaaaacgcggtgaagattgcc
cgcgcggccaccggtcgtccgggcgttatcgctttcaccggcgctttccatggccgcacc
atgatgaccatgggcctgaccggcaaagtggtcccctacaaaaccggctttggaccgttc
ccggggtcggtgttccatgcccgttacccgaacgcgctgcatgggcacagcatcgacgat
gcgatggagagcctggaatccctgttccgctgcgacatcagcccacagcaggtcgccgcc
attatcttcgaaccgatccagggcgaaggcggcttcaatatcgcgccagtcgagtttgtc
agcaaactgcgcacgctctgcgaccaacacggcattctgctgattgccgacgaaattcag
accggctttgcccgcaccggcaagctgtttgcctgcgaatactacccggatgccaaacct
gacctgatcaccatggcgaagagcctgggcggtggtctgccgatctctgccgtctccgga
cgtgccgaagtgatggatgccccactgcctggcggactgggtggcacctatgccggcaac
ccgctggccattgcctcttcgctggcggtactggaggtgattgacgaagaagcgctgtgt
gaccgcgcgctgcgtctgggtgctgaactggttgaaacgctcaacggctgcggcaatccg
gcgctggttgaagtgcgtgcccgaggctcgatggtggccgccgaattcaacgatccggca
accggcaaaccttctgcggaaatcgccaaaaacattcagcaaaaagcgctggaacacggc
ctgatcctgctgacctgtggcgtgcatggcaacgtcatccgcttcctttatccactgact
attccggacgcccagtttaaacaggcgctgacgctgctcgacacgctgttgcgcgcgtag

DBGET integrated database retrieval system