KEGG   Escherichia coli B REL606: ECB_02851Help
Entry
ECB_02851         CDS       T00944                                 

Definition
(GenBank) putative saframycin Mx1 synthetase B
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     ECB_02851
Lipid biosynthesis proteins [BR:ebr01004]
 Acyl-CoA synthetase
  Unknown
   ECB_02851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3057445..3059175
Genome map
AA seq 576 aa AA seqDB search
MVYMSNKIFTHSLPMRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQTLKARAE
AGAKRLLSLNLKKGDRVALIAETSSEFVEAFFACQYAGLVAVPLAIPMGVGQRDSWSAKL
QGLLASCQPAAIITGDEWLPLVNAATHDNPELHVLSHAWFKALSEADVALQRPVPNDIAY
LQYTSGSTRFPRGVIITHREVMANLRAISHDGIKLRPGDRCASWLPFYHDMGLVGFLLTP
VATQLSVDYLRTQDFAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDLAELDLSC
WRVAGIGAEPISAEQLHQFAECFRQVNFDNKTFMPCYGLAENALAVSFSDEASGVVVNEV
DRDILEYQGKAVAPGAETRAVSTFVNCGKALPEHGIEIRNEAGMPVAERVVGHICISGPS
LMSGYFGDQVSQDEIAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWPQDIEYIA
EQEPEIHSGDAIAFVTAQEKIILQIQCRISDEERRGQLIHALAARIQSEFGVTAAIALLP
PHSIPRTSSGKPARAEAKKRYQKAYAASLNVQESLA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtatatgtctaataaaatctttacgcattccctacctatgcgctatgccgatttt
ccaacgcttgttgatgctttggactacgccgctctgagtagcgccggaatgaatttttat
gacagacgttgccaacttgaagatcaactggaatatcagacgttaaaagcacgtgccgaa
gctggtgcgaagcggttgttatcgctgaacctgaaaaaaggcgatcgcgtggcactgatt
gccgaaacaagtagcgagttcgtagaggctttttttgcctgccagtatgccggcttagtc
gccgtcccgttggcgattccaatgggcgttggtcagcgggattcctggagcgccaaattg
cagggtttactggcaagttgccagcccgcagccattatcactggtgatgagtggttgcca
ctggtcaatgccgcgacgcatgacaaccccgaattacatgttttaagccacgcttggttt
aaggcattatcggaagccgatgttgcgctccagcgtccagttccgaacgatatcgcctac
ctccagtacacctccggcagcacccgttttccccgtggcgtcattatcacccatcgcgaa
gtgatggctaatctacgtgctataagccacgacggcattaaattacgccctggcgaccgc
tgcgcctcctggctgcctttctaccatgatatgggactggtcggctttctcctgaccccc
gtcgccacgcagctttcagtagattatttgcgcactcaggattttgccatgcgtcctctg
caatggcttaaattgatcagtaaaaatcgcggcaccgtttccgttgcgccgccgtttggc
tatgaattgtgccagcgccgcgtgaatgaaaaagatctcgctgaactggatctttcctgc
tggcgcgtcgctggtattggtgcagaacccatctccgcagaacaactccatcaattcgct
gaatgtttccgtcaggttaactttgacaataaaactttcatgccgtgctacggactggca
gaaaatgcgctggctgtcagcttctctgatgaagcctccggggttgtggttaacgaagtg
gatcgcgacatcctcgaatatcagggtaaagccgtcgcgccgggtgcagagacacgcgcc
gtatcgactttcgtcaactgcggcaaagcgttgccggaacatggtattgaaatccgcaat
gaagcaggtatgccggtcgcggaacgtgtggtaggccatatttgcatctccggtcccagt
ctgatgagcggttactttggcgaccaggtttcgcaagacgagattgccgcgacgggctgg
ttagacaccggcgacctcggttatctgctggacggttatctgtatgtcaccggacgcatt
aaagatctgattattattcgtggccgtaatatctggccgcaggatattgaatatatagcg
gaacaggaaccggaaattcattctggcgatgcgattgcttttgttaccgcccaggaaaaa
atcattttgcagatccagtgtcggatcagcgacgaagaacgtcgcgggcagcttatccac
gcgctggcggcacggatccaaagcgaatttggcgtgaccgcggctatcgctctgttgccg
ccccacagtattccccgaacgtcctccggcaagcctgcccgtgcggaagcgaaaaaacgt
tatcagaaggcttatgctgccagtcttaatgtgcaggaatccctggcatga

DBGET integrated database retrieval system