KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_0405Help
Entry
ECTOBSL9_0405     CDS       T04374                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00473  D-Alanine metabolism
ebs00550  Peptidoglycan biosynthesis
ebs01100  Metabolic pathways
ebs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ebs00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECTOBSL9_0405
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECTOBSL9_0405
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ECTOBSL9_0405
Enzymes [BR:ebs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ECTOBSL9_0405
Peptidoglycan biosynthesis and degradation proteins [BR:ebs01011]
 Precursor biosynthesis
  Amino acid ligase
   ECTOBSL9_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: ANB01323
UniProt: A0A167A0I1
LinkDB All DBs
Position
complement(393162..394097)
Genome map
AA seq 311 aa AA seqDB search
MNHSNVADFGKVAVLMGGWSAEREVSLRSGAEVLKALRAAGVDAHGVDVGRDILDVLARE
RYDRAFIVLHGRGGEDGVIQGALEVLGLPYTGSGVAGSALGMNKLLTKRLWRGAGLPTPD
FRVLEQDTDPRAVAEALGLPLIVKPALEGSSIGMTKVSQREELGQAQETAARCGGPVFAE
HWVRGAEYTVAILDGQALPPIRLETPRAFYDYEAKYQSDDTLYHCPCGLPADEEASLQRL
ALDAFKAVSGEGWGRVDLMLDGQGGAWLIEVNTVPGMTDHSLVPMAARAAGLDFQALVVR
ILATTLTPGGR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcgaacgtggcggattttggcaaggtggcggtgctcatgggcggctggtcc
gcggagcgggaggtttcgctgcgcagcggtgccgaggtgctcaaggccctgcgtgccgcc
ggtgtggacgcccatggcgtggatgtggggcgggacatcctggatgtactggcccgggaa
cggtacgacagggcctttatcgtcctgcacggccggggcggagaggatggcgtcatccag
ggagccctggaggtgctgggcctgccttataccggcagcggcgtggccggctcggccctg
gggatgaacaagctgctgaccaaacgcctgtggcgcggcgccggtctgcccacgccggac
ttccgggtgctggagcaggacacggatccccgcgccgttgcagaggctctgggtctgccc
ctgatcgtcaagccggccctggagggctccagtattggcatgaccaaggtgtcacaacgg
gaggaactgggtcaggcacaggagacggccgcccgctgtggcgggccagtctttgccgaa
cactgggtgcgtggcgccgagtacaccgtcgccatcctggatggacaggccctgccgccg
atccgcctggaaacgccgcgggcgttttacgactacgaggccaagtatcaatcggatgac
accctctaccactgcccctgcgggctgcccgccgatgaggaggcgagtttgcagcgactg
gccctggatgccttcaaggcggtatccggcgagggctggggtcgggtggacctgatgctg
gatggacagggcggcgcctggctcatcgaggtgaatactgtgccgggcatgacggatcac
agtctcgtccccatggccgcccgtgcggcgggtctggatttccaggccctggtcgtccgt
attctggccacaaccctgacgccgggagggcggtga

DBGET integrated database retrieval system