KEGG   Shimwellia blattae: EBL_c39860Help
Entry
EBL_c39860        CDS       T02111                                 

Definition
(GenBank) putative AMP-dependent synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ebt  Shimwellia blattae
Brite
Enzymes [BR:ebt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     EBL_c39860
Lipid biosynthesis proteins [BR:ebt01004]
 Acyl-CoA synthetase
  Unknown
   EBL_c39860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4127877..4129640
Genome map
AA seq 587 aa AA seqDB search
MAASYMSETSSTHSLPMRYADFPTLVEALDYAAQGSTGMNFYDRRNQLVAVLEYSDLKRR
AMANARRLLSLNLNRGDRVALIAETSVGFVEAFFACQYAGLVAVPLAIPMGVGQRDSYTT
KLQGLIASCKPAAIISSEEWLPLINSVSADAPDTHILSGEDLHALPEKDIELTPPSPDDI
AYLQYTSGSTRFPRGVIITHRSVMANLHVISHDGIKLRAGDRCVSWLPFYHDMGLVGFLL
TPVATQLSVDYLRTQDFAMRPMQWLKLISKNRGTVSVAPPFGYELSLRRSNEKDMAELDL
SCWRVAGVGAEPISAEQLDQFGKHFSKVGFDSKGFMPCYGLAENALAVSFSDENGGSQVN
EVDRDILEYQGKAVAPTKDTRAVSTFVNCGKALPGHRIEIRSETGIPLPEREVGHIYISG
PSLMSGYFRDAASQKEVQSTGWMDTGDLGYLLDGYLYVTGRKKDLIIIRGRNIWPQDIEY
VAELEPEIHSGDAIAFITPQDQEESGRIILQVQCRVSSEERRAQIVHSLTARIQSEFGVA
VDIELLPPHSIPRTSSGKPARAEAKKRYLTAMTETLTPQIQMAGYAQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcgtatatgtctgaaacaagttcaacccactctcttcccatgcgctatgct
gattttccgaccctggtggaggcgttagactatgccgcacagggaagtacagggatgaat
ttctacgatcggcgtaaccagcttgtagccgtactggaatatagcgacttaaaacgccgg
gcgatggcgaatgcacgccgcctgttatcgcttaaccttaaccggggcgatcgcgttgcg
cttattgctgaaaccagcgttggcttcgtggaagccttttttgcctgccagtacgcaggg
ctcgtcgctgtaccgcttgccattccgatgggtgttggccagcgtgactcctacacgacg
aaactgcaggggctgattgccagctgcaaaccggcggccatcatcagcagcgaagagtgg
ctgccgcttatcaattcggtgagcgcagatgcgccggatacccacatcctcagcggtgaa
gatctgcacgcgctgccggaaaaggatatcgagctgacgccgccctccccggatgatatt
gcctacctgcagtacacctccggcagtacccgtttcccgcgtggggtaattatcacccac
cgctccgtgatggcgaacctgcacgttatcagccatgacggtattaaattgcgcgccggc
gatcgctgcgtgtcctggctgccgttctaccacgatatggggctggtgggctttctgctg
acaccggttgcgacccagttgtccgtggactacctgcgcacccaggatttcgccatgcgc
ccgatgcagtggctgaaacttatcagcaaaaaccgtggcaccgtctctgttgcgccgcca
tttggctatgagctgagcctgcgccgcagcaatgaaaaagatatggcggaactggatctc
tcctgctggcgcgtggccggtgtgggggcggagccaatttccgcagagcagctggatcag
ttcggcaagcatttcagtaaagtgggctttgacagcaaaggctttatgccgtgctatggc
ctggcggaaaacgccctggccgtgagcttctctgatgaaaatggcggctctcaggtcaac
gaagtggaccgcgatatccttgaatatcagggcaaagccgttgcgccaacaaaagacacc
cgggcagtatccacctttgtgaactgcggtaaagcgctgccgggccaccggattgagatc
cgcagtgaaaccggtattccgctgccggagcgtgaagttggccatatttatatctccggc
ccgagcctgatgagcggctacttccgtgacgcggcctcccagaaagaggtgcagtccacc
ggctggatggataccggcgatctgggttacctgttagacggctacctgtatgttaccggg
cgtaaaaaagatctgattatcatccgcgggcgcaatatctggcctcaggatattgaatat
gtggctgaacttgagcctgagatccactccggtgatgcgattgcgtttattacgcctcag
gatcaggaagagagcgggcgcattattctgcaggttcagtgccgcgtcagctctgaagag
cgccgcgcgcagattgtgcactccctgacggcccgcatccagagcgagttcggggttgcg
gttgatattgaattactgccgccgcacagcattccgcgcacctcttccggtaagccggcc
cgcgctgaagcgaaaaaacgctatctgaccgccatgaccgaaaccctgacgccgcagata
cagatggcgggttacgctcaatga

DBGET integrated database retrieval system