KEGG   Equus caballus (horse): 100070705Help
Entry
100070705         CDS       T01058                                 

Gene name
TMPRSS5
Definition
(RefSeq) transmembrane protease, serine 5
  KO
K09636  
transmembrane protease serine 5 [EC:3.4.21.-]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100070705 (TMPRSS5)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100070705 (TMPRSS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
7
AA seq 485 aa AA seqDB search
MYRFVYMTYLQDSASLMLDGQAPMEAQYAEEGPGPGIFRSVLGDPLWRPEAQQQPISPSR
RWCSRRRGCAVLGALGLLAGASVGSWLLVLYLWPAASQPVPRNSQDEEMTLNCSEASGGE
EALLPSIPKAVSFRINKEDFLLQVQVRARPDWLLVCHEGWSSALGVRICRSLGHLRLTHH
KGVNLSDLKLNSSQEFAQLPPRLGGLLEEVWQPRDNCTSGQIVSLKCSECGARPLASRIV
GGQAVAPGRWPWHASVALGSRHTCGGSVLAPHWVVTAAHCMHSFRLSRLSSWRVRVGLVS
HSMVRTHQGAVVERIIPHPLYSAQNHDYDVALLRLRTPLDFSDTVGAVCLPAEEQDFPRG
SQCWVSGWGHTDPSHAHSSDTLQDMVVPLLSTQLCNSSCVYSGALTPRMLCAGYLDGRAD
ACQGDSGGPLVCQDGGTWRLVGVVSWGHGCAEPNHPGVYAKVAELLDWIQDTAWVSVGAG
VRGGM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgctttgtttacatgacttatcttcaggactcagctagcctgatgctggacggc
caagcccccatggaggctcagtatgcagaggagggcccagggcccgggatcttcagatct
gtgctgggagacccactatggagaccggaggcccagcagcaacccatctctccgtcaaga
cgctggtgctccaggcggcgtggctgtgcagtgctgggagccctggggctgctggctggg
gcgagtgtcggctcatggcttctagtgctgtatctgtggccagctgcctctcagcctgtt
ccgcggaactcgcaggatgaggagatgactttgaactgctcagaggccagcggtggcgag
gaagccctcctcccctcaattcccaaagcagtatctttcagaataaacaaggaggacttc
ttgctgcaagtacaggtgagggcccggccagactggctcctggtctgccatgagggctgg
agctctgccctgggggtgcggatctgccgcagcctggggcacctcagactcactcaccac
aagggagtgaacctgtctgacctcaagctcaacagctcccaggagtttgctcagctccct
cctagactgggaggcctcctggaggaggtgtggcagcccagggacaactgcacttctggc
caaatcgtttccctcaaatgctctgagtgtggggcaaggcccctggcttcccggatagtc
ggggggcaggccgtggctcctgggcgctggccatggcatgccagcgtggccctgggctcc
cggcacacgtgcgggggctccgtgctggcgccacactgggtggtgaccgctgcgcactgc
atgcacagtttcaggctgtcccgcctgtccagctggcgggtccgtgtgggattggtcagc
cacagcatggtcaggacacaccagggggctgtggtggagaggatcatcccccacccactc
tacagcgcccagaatcacgactatgacgtcgccctcctgcggctccggaccccactcgat
ttctcagacaccgtgggcgctgtgtgcctgccggccgaggagcaagattttcccaggggc
tcgcagtgctgggtgtctggctggggccacactgaccccagccatgcccacagctcagac
acactgcaggacatggtggtgcccctgctcagcacccagctctgcaacagctcttgcgtg
tacagcggggccctcaccccccgcatgctgtgtgccggctacctggacgggagggccgat
gcatgccagggggatagcgggggtcccctggtgtgccaggatgggggcacatggcgcctg
gtgggggtggtcagctggggccatggctgcgcagagcccaatcaccccggtgtctatgcc
aaggtcgctgagctcctggactggatccaggacacagcatgggtgagtgtgggggcaggt
gtgcggggaggtatgtaa

DBGET integrated database retrieval system