KEGG   Equus caballus (horse): 100146332Help
Entry
100146332         CDS       T01058                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100146332 (TMPRSS9)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100146332 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
7
AA seq 1096 aa AA seqDB search
MEPTVGDLQLTPGATKEVPAPDAACCRAALSAVVATSIIVITLGALVASFSTQGVAVEHA
ARLGGLRYAASLQREGSAYHRALTAALQTLFVSSFQETELEASCVGCTVLSYRNGNSSVL
VHFRLHFVLQALETLSPGLEEELLQRGLRARLQGRGLPLAAYGTIVSAQLIGNQRGPPTD
RDMKSGRCPADAFACGNSRCVTKVNPECDDSVDCPDGSDEARCDCGLQPGWRTAGRIVGG
VAASPREFPWQVSLRENGEHFCGAAVVGARWLVSAAHCFNEFQDPTEWVAYAGTTSLSGS
EASTVRARVARIVTHPAYDSDTADFDVAVLELGSPLPFSRHVQPVCLPAATHIFPPRRKC
LISGWGYLKEDFLVKPERLQKATVELLDQALCAGLYGPSLTDRMLCAGYLDGKVDSCQGD
SGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTSLSNWILEAIATPSKPPAPTV
APAPATSSTAWPSSAESRGVDTPTPPMLAPSPVPQDPVTASKPQECGVRPALEKPSRIVG
GLGAAPGEVPWQASLEEGSRHFCGAAVVGDRWLLSAAHCFNHTKVELVQAHLGTASLAGV
GGSPVKMGLKRAVLHPQYDPGLLDFDVAVLELAGPLVFNKYVQPVCLPLAVQKFPVGRKC
MISGWGNTQEGNASKPDILQRASVGIIDQKACSALYNFSLTDRMLCAGFLEGQVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYSRVTRLKGWILDTMSSQPLPAPPPA
TMRTPATTSQAPRTTAGLTAPGVTASRPTPPATSGATSQPANRTTTAMGTTTRGQTPLPH
APETTLGPQPPDCGLAPAAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWL
LSAAHCFDVYGDPKQWAAFLGTPFLSGADGQLERVARIHRHPFYNLYTLDYDVALLELAG
PVRRSRLVRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRF
YPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVY
TRVAAVRGWIGQNIQE
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgtgggtgacttacagctcacgcccggggccacaaaggaagtccctgct
ccagatgccgcatgctgccgagcggccctctctgctgtcgtggccaccagcatcatcgtc
atcaccctgggagccctcgtggcctccttctccacgcagggcgtcgccgtggagcatgcg
gcccggctggggggcctgcgctacgccgccagcctgcagcgggagggctcggcctaccac
cgcgcgctgaccgccgccctgcagacactgtttgtgagcagctttcaggagacggagctg
gaggccagctgcgtgggctgcacggtgctaagttacaggaacgggaactccagcgtcctc
gtgcacttccggctgcactttgtgctgcaagcgctggagacgctgagcccgggcctggag
gaggagctgctgcagcggggtctccgcgcgaggctgcaggggcgaggcctccccctggct
gcctacggcaccatcgtgtccgcccagctcataggcaaccagcgggggccaccgacggac
agagacatgaaatcaggtcgctgcccggcggacgccttcgcctgcgggaacagccggtgt
gtcactaaggtgaaccccgagtgtgacgacagcgtggactgccccgatggatccgacgag
gcccgctgtgactgcggcttgcagcccggctggaggacggcgggcaggatcgtgggcggc
gtggcggcgtcccccagggagttcccgtggcaagtcagcctccgagagaacggcgagcac
ttctgcggggcggccgtggtcggggcccggtggctggtgtcggccgcccactgcttcaac
gaattccaagaccccacggagtgggtggcctacgcgggcaccacctccctcagcggctcg
gaggccagcaccgtgcgggcccgcgtggcccggatcgtcacacaccccgcctacgactcg
gacacggccgacttcgacgtggcggtgctggagctgggcagccccctccccttcagcagg
cacgtccagcccgtgtgcctgccggccgccacgcacatcttcccgccccggaggaagtgt
ctcatctcgggctggggctacctcaaggaggacttcctggtcaagccggagaggctgcag
aaggccaccgtggagctgctggaccaggccctgtgcgccggcctgtacggcccctcgctc
accgaccggatgctgtgcgccggctacctggacggcaaggtggactcctgccagggggac
tcggggggccccctggtctgcgaggagccgtccggcaggttcttcctggccggcatcgtg
agctggggaatcgggtgcgcagaagcgcggcggccgggggtctacgcccgagtgaccagc
ctgagcaactggatcctggaggccatcgccaccccgagcaagcccccggcccccactgtg
gcccctgcgcccgccacctccagcaccgcctggcccagcagcgccgagagccggggggtg
gacactcccaccccacccatgctggcccccagccctgtgcctcaggacccagtcactgcg
tctaagccgcaagagtgcggggtccggccggccctggagaagcccagccgcatcgtgggc
gggctgggagccgcccccggggaggtgccctggcaggccagcctggaggaggggtcccgg
cacttctgcggagcggccgtggtgggggaccgctggctgctgtcggccgcgcactgcttc
aaccacaccaaggtggagctggtgcaggcccacctgggcaccgcgtccctcgcgggtgtc
ggcgggagcccggtgaagatggggctcaagagggcggtgctgcacccccagtacgacccc
ggcctcctggacttcgacgtggccgtgctggagctggcggggcccctagtcttcaacaag
tacgtgcagcccgtctgcctgccgctggccgtccagaagttccccgtgggccgcaagtgc
atgatctccggctgggggaacacgcaggaggggaacgcgtccaagcctgacatcctgcag
cgcgcgtcggtgggcatcatagaccagaaggcgtgcagcgcgctgtacaacttctcgctc
accgaccggatgctgtgcgccggcttcctggagggccaggtggactcctgccagggcgac
tcggggggccccctggcctgcgaggagacccccggtgtgttttacctggcgggcatcgtg
agctggggcatcggctgtgctcaggccaaaaagcccggcgtgtactcgcgcgtcaccagg
ctgaagggctggatcctggacaccatgtcctcgcagcccctccccgcgccacccccagcc
accatgaggacgcccgccaccaccagtcaggcccccaggacgacggctggcctcacagcc
ccgggggtcacggccagcagacccacccccccggccaccagcggggcgaccagccaacct
gccaacaggaccaccaccgccatggggaccaccaccaggggacagacgccgcttccacac
gccccggagaccaccctggggccccagccaccagactgcggcctggcgccggcggcggcg
ctgaccaggatcgtgggcggcagcgcggcgggccgcggggagtggccgtggcaggtgagc
ctgtggctgcggcgccgggagcaccgctgcggggccgtgctggtggccgagaggtggctg
ctgtcggcggcgcactgcttcgacgtctacggggaccccaagcagtgggcggccttcctg
ggcactccgttcctgagcggcgcggacgggcagctggagcgcgtggcgcgcatccacagg
caccctttctacaacctctacacgctcgactacgacgtggcgctgctcgagctggcgggg
cccgtgcgccgcagccgcctggtgcgccccatctgcctgcccgagcccgcgccccggccc
cccgacggcgcgcgctgcgtcatcaccggctggggctcggtgcgcgagggaggctcgatg
gcgcggcagctgcagaaggcggccgtgcgcctcctgagcgagcagacgtgtcgccgcttc
tacccggtgcagatcagcagccgcatgctgtgcgcgggcttcccgcagggcggcgtggac
agctgctcgggtgacgctgggggcccccttgcctgcagggagccctccggccggtgggtg
ctaactggggtcaccagctggggttacggctgcgggcggccccacttcccgggcgtctat
acccgggtggctgccgtgagaggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system