KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3210Help
Entry
c3210             CDS       T00106                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    c3210 (gabT)
   00650 Butanoate metabolism
    c3210 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    c3210 (gabT)
   00280 Valine, leucine and isoleucine degradation
    c3210 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    c3210 (gabT)
Enzymes [BR:ecc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     c3210 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     c3210 (gabT)
Amino acid related enzymes [BR:ecc01007]
 Aminotransferase (transaminase)
  Class III
   c3210 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3071401..3072687
Genome map
AA seq 428 aa AA seqDB search
MRMSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHL
HPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENA
VKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGI
SEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIA
DEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTY
AGNPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIE
LFEDGEHSKPDVKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIS
QCFAEAKQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggc
gttgggcaaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgtt
gaaggccgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctg
catccgaaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttc
caggtgctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccg
ggcgattttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcg
gtgaaaatcgcccgcgccgccaccaaacgtagcgggaccatcgcctttagcggtgcgtat
cacgggcgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggc
atggggctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcata
agcgaggatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaa
gatatcgccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacg
ccagcctttatgcagcgtttacgcgcgctgtgtgacgagcatgggatcatgctgattgcc
gatgaagtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggc
gtggcaccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggc
gtcaccgggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctat
gccggtaacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaa
aatctgctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatc
gccgaaaaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccatcgag
ctgtttgaagatggcgaacacagcaaaccggacgtaaaactcaccgccgagatcgtggca
cgcgcccgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgc
atccttgtaccgctcaccattgaagacgctcagatccgtcagggtctggaaatcatcagc
cagtgttttgctgaggcgaagcagtag

DBGET integrated database retrieval system