KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3960Help
Entry
Z3960             CDS       T00044                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase activity
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Z3960 (gabT)
   00650 Butanoate metabolism
    Z3960 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Z3960 (gabT)
   00280 Valine, leucine and isoleucine degradation
    Z3960 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Z3960 (gabT)
Enzymes [BR:ece01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Z3960 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Z3960 (gabT)
Amino acid related enzymes [BR:ece01007]
 Aminotransferase (transaminase)
  Class III
   Z3960 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3582212..3583492
Genome map
AA seq 426 aa AA seqDB search
MSSXKELMXXRSXAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQXGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcantaaagagttaatgcancnccgcagtnaggcaattcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgctgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggc
ctgatgccagggcacgtttatcgcgcgctttatccttgcccactgcacggcatcagtgaa
gatgatgctatcgccagtatccaccgaatttttaaaaatgatgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgcctgcg
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagarcggcgcggggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggcttcccactggcgggcgtcacc
gggcgcgccgaagtgatggatgccgtcgctccaggcgggctgggtggcacctatgccggt
aatccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcagaaagccaacgatctggggcagaagttgaaagatggattgttggcgatcgccgaa
aaacaccctgagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcaaagcagtag

DBGET integrated database retrieval system