KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z5453Help
Entry
Z5453             CDS       T00044                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, manganese
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Brite
Enzymes [BR:ece01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Z5453 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4969534..4970154
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcagacctacgtcaacaacgccaac
gcggcgttggaaagcctgccagaatttgccaacctgccggttgaagagttgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggtcacgct
aaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgacctgaaa
gcggctatcgaacgtgatttcggttccgtagataacttcaaagcagaatttgagaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaactggcg
gtggtttctactgctaaccaagactccccgctgatgggtgaagctatttctggcgcatcc
ggcttcccgattctgggcctggatgtgtgggagcatgcttactacctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgtttcgcggcgaaaaaataa

DBGET integrated database retrieval system