KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0319Help
Entry
E2348C_0319       CDS       T00796                                 

Gene name
phoA
Definition
(GenBank) bacterial alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00730  Thiamine metabolism
ecg00790  Folate biosynthesis
ecg01100  Metabolic pathways
ecg02020  Two-component system
Module
ecg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    E2348C_0319 (phoA)
   00790 Folate biosynthesis
    E2348C_0319 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    E2348C_0319 (phoA)
Enzymes [BR:ecg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     E2348C_0319 (phoA)
Exosome [BR:ecg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   E2348C_0319 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecg00537]
 Enzymes
  E2348C_0319 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: CAS07867
UniProt: B7UJK7
LinkDB All DBs
Structure
PDB: 

Jmol
Position
360903..362318
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDTASLNSVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggactcggaaatt
actgccgcacgcaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaactggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagtgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgcc
cgtgccgatgttacgcttggcggcggtgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatactgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctattaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggtaat
atagataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccgacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgcagcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gatggtaacacgttggtcatagtcaccgctgatcacgcccatgccagccagatagttgcg
ccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system