Escherichia coli K-12 W3110: JW0724 Help Entry JW0724            CDS       T00068                                  Symbol ybgT Name (GenBank) conserved hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ecj  Escherichia coli K-12 W3110 Pathway ecj00190   Oxidative phosphorylation ecj01100   Metabolic pathways ecj02020   Two-component system Module ecj_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ecj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     JW0724 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     JW0724 (ybgT) Enzymes [BR:ecj01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      JW0724 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  BAE76359 UniProt:  P56100 Structure PDB LinkDB All DBs Position 774618..774731 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system