KEGG   Escherichia coli K-12 W3110: JW1295Help
Entry
JW1295            CDS       T00068                                 

Gene name
puuE
Definition
(GenBank) GABA aminotransferase, PLP-dependent
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00250  Alanine, aspartate and glutamate metabolism
ecj00410  beta-Alanine metabolism
ecj00640  Propanoate metabolism
ecj00650  Butanoate metabolism
ecj01100  Metabolic pathways
ecj01120  Microbial metabolism in diverse environments
Module
ecj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JW1295 (puuE)
   00650 Butanoate metabolism
    JW1295 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JW1295 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JW1295 (puuE)
Enzymes [BR:ecj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     JW1295 (puuE)
Amino acid related enzymes [BR:ecj01007]
 Aminotransferase (transaminase)
  Class III
   JW1295 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAA14871
UniProt: P50457
LinkDB All DBs
Position
1367264..1368529
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgccactccgcgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgccacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccggacatcgccaccctgat
ctggtcgcggcggtggagcagcaactgcaacagtttacccacaccgcgtatcagattgtg
ccgtatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcaccaccggtgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgccctggcgtgattgcgtttagcggcggctttcacggtcgt
acgtatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtggcg
gcgattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgctattcgccgcctgtgcgacgagcacggtattgtgatgattgctgatgaagtg
caaagcggctttgcgcgtaccggtaagctgtttgccatggatcattacgccgataagccg
gatttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcacccgcgccgggcgggcttggcggcacctacgccggtaac
ccgctggcggtggctgccgcgcacgcggtgctcaacattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggtagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system